H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000645877 Accession number: FJ385457 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to Ig kappa chain V-IV region; Precursor; Fragment;
 
 

Motif information
ORF

length(98),orf(2:296)
DSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWAS
TRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPWTFGQ
a.a.
length
InterPro Name
length(87), motif(1:87) 87 IPR007110 Immunoglobulin-like [Domain]
length(97), motif(2:98) 97 IPR013783 Immunoglobulin-like fold [Domain]
length(97), motif(2:98) 97 IPR013106 Immunoglobulin V-set [Domain]
length(79), motif(10:88) 79 IPR003596 Immunoglobulin V-set, subgroup [Domain]