H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000484921 Accession number: EU427373 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to Alpha-chain C region; Fragment;
 
 

Motif information
ORF

length(186),orf(264:824)
TVLFIAAHPPGAGGRCCCLLLCCGGFSGGSYIPTFGRGTSLIVHPYIQNP
DPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSM
DFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFE
TDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS*
a.a.
length
InterPro Name
length(88), motif(47:134) 88 IPR013783 Immunoglobulin-like fold [Domain]
length(84), motif(52:135) 84 IPR015370 Domain of unknown function DUF1968 [Domain]