H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000432417_05 Accession number: AK313551 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: HLA class II histocompatibility antigen, DO alpha chain; MHC DN-alpha; MHC DZ alpha; MHC class II antigen DOA; Precursor;
 
 

Motif information
ORF

length(250),orf(30:782)
MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTH
EFDEEQLFSVDLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILV
ERSNRSRAINVPPRVTVLPKSRVELGQPNILICIVDNIFPPVINITWLRN
GQTVTEGVAQTSFYSQPDHLFRKFHYLPFVPSAEDVYDCQVEHWGLDAPL
LRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLIIMGTYVSSVPR
*
a.a.
length
InterPro Name
length(78), motif(28:105) 78 IPR014745 MHC class II, alpha/beta chain, N-terminal [Domain]
length(84), motif(29:112) 84 IPR011162 MHC classes I/II-like antigen recognition protein [Domain]
length(82), motif(29:110) 82 IPR001003 MHC class II, alpha chain, N-terminal [Domain]
length(81), motif(30:110) 81 IPR001003 MHC class II, alpha chain, N-terminal [Domain]
length(115), motif(109:223) 115 IPR013783 Immunoglobulin-like fold [Domain]
length(81), motif(113:193) 81 IPR007110 Immunoglobulin-like domain [Domain]
length(81), motif(119:199) 81 IPR003597 Immunoglobulin C1-set [Domain]
length(72), motif(128:199) 72 IPR003597 Immunoglobulin C1-set [Domain]
length(7), motif(187:193) 7 IPR003006 Immunoglobulin/major histocompatibility complex, conserved site [Conserved_site]