H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000425669 Accession number: AK292872 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase isoform a.
 
 

Motif information
ORF

length(359),orf(283:1362)
MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVN
SSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKS
SFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGI
LLDSECGKEIDSHNFVIRCNLAPVVEFAADVGTKSDFITMNPSVVQRAFG
GFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNALILKNKLK
VRTAYPSLRLIHAVRGYWLTNKVPIKRPSTGLLMYTLATRFCDEIHLYGF
WPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALK
LTTGKCVKQ*
a.a.
length
InterPro Name
length(357), motif(1:357) 357 IPR012163 Sialyltransferase [Family]
length(264), motif(92:355) 264 IPR001675 Glycosyl transferase, family 29 [Family]