H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000422812 Accession number: AK290015 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: R3H domain-containing protein 1;
 
 

Motif information
ORF

length(1100),orf(320:3622)
MRMSDTVTVKDETATMKDLEAEVKDTTRVENLIKSENYGKILVEKNEHCI
ENNIDLQRPLQSFGQTGKRSKSSSKLKLVRSLAVCEESPPPPAPEISQEN
QEKIQIQLTQSFEKEEKPSKDEAEEEKASDKLPRKMLSRDSSQEYTDSTG
IDLHEFLVNTLKNNPRDRMMLLKLEQEILDFIGNNESPRKKFPPMTSYHR
MLLHRVAAYFGLDHNVDQSGKSVIVNKTSNTRIPDQKFNEHIKDDKGEDF
QKRYILKRDNSSFDKDDNQMRIRLKDDRRSKSIEEREEEYQRARDRIFSQ
DSLCSQENYIIDKRLQDEDASSTQQRRQIFRVNKDASGRSTNSHQSSTEN
ELKYSEPRPWSSTDSDSSLRNLKPAVTKASSFSGISVLTRGDSSGSSKSI
GRLSKTGSESSGSVGSSTGSLSHIQQPLPGTALSQSSHGAPVVYPTVSTH
SSLSFDGGLNGQVASPSTSFFLLPLEAAGIPPGSILINPQTGQPFINPDG
SPVVYNPPMTQQPVRSQVPGPPQPPLPAPPQQPAANHIFSQQDNLGSQFS
HMSLARQPSADGSDPHAAMFQSTVVLQSPQQSGYIMTAAPPPHPPPPPPP
PPPPPPLPPGQPVPTAGYPASGHPVSQPVLQQQGYIQQPSPQMPACYCAP
GHYHSSQPQYRPVPSVHYNSHLNQPLPQPAQQTGYQVIPNQQQNYQGIVG
VQQPQSQSLVSGQPNSIGNQIQGVVIPYTSVPTYQVSLPQGSQGIPHQTY
QQPVMFPNQSNQGSMPTTGMPVYYSVIPPGQQNNLSSSVGYLQHPGSEQV
QFPRTTSPCSSQQLQGHQCTAGPPPPPGGGMVMMQLSVPNNPQSCAHSPP
QWKQNKYYCDHQRGQKCVEFSSVDNIVQHSPQLSSPIISPAQSPAPAQLS
TLRTVRPSGPPLSIMPQFSRPFVPGQGDSRYPLLGQPLQYNPPAVLHGHI
PNQQGQPGSRHGNRGRRQAKKAASTDLGAGETVVGKVLEITELPDGITRM
...
a.a.
length
InterPro Name
length(122), motif(140:261) 122 IPR001374 Single-stranded nucleic acid binding R3H [Domain]
length(78), motif(151:228) 78 IPR001374 Single-stranded nucleic acid binding R3H [Domain]
length(64), motif(168:231) 64 IPR001374 Single-stranded nucleic acid binding R3H [Domain]
length(61), motif(168:228) 61 IPR001374 Single-stranded nucleic acid binding R3H [Domain]
length(64), motif(171:234) 64 IPR001374 Single-stranded nucleic acid binding R3H [Domain]
length(71), motif(232:302) 71 IPR024771 SUZ domain [Domain]
length(51), motif(251:301) 51 IPR024771 SUZ domain [Domain]