H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
Locus viewLocus view Protein view Protein view G-integraG-integra DiseaseInfo ViewerDiseaseInfo Viewer H-ANGELH-ANGEL EvolaEvola PPI viewerPPI view Gene Family/GroupGene Family/Group Hyperlink managemnet system (All databases)Hyperlink MS
H-Invitational ID: HIT000388793 Accession number: BC126201 Created date: 26-Mar-2013 Last modified: 20-Apr-2012
Definition: Receptor-type tyrosine-protein phosphatase O isoform a precursor.
 
 

Transcript original information
Accession number BC126201.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:161479 IMAGE:8991917
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (PTPRO) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (PTPRO);
Sequence data provider NA
Annotation project NA
Length of cDNA 5147[bp] (No. of exon:27)[A:1440 T:1451 G:1141 C:1115]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Brain, cerebellum, PCR rescued clones
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0026345
Genomic location  G-integra Help Chromosome 12
Location 12p12.3
Position 15475491- 15750333
Strand +
Possible duplicated location(s) NA
Gene structure 27 exon(s)
Database links RefSeq NM_002848NM_030667NM_030668NM_030669NM_030670NM_030671
Ensembl ENST00000281171ENST00000348962ENST00000442921ENST00000445537ENST00000535311ENST00000535322ENST00000538907ENST00000542557ENST00000543886ENST00000544244ENST00000544706ENST00000545023
Entrez Gene Entrez Gene ID:5800
KEGG GENES KEGG GENES(5800)
GeneCard GeneCardPTPRO*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000056850
Predicted CDS 171..3821;  1216[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.747
Database links RefSeq NP_109592
UniProt Q16827
CCDS CCDS8675

Motif information
ORF

length(1216),orf(171:3821)
MGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNIVVSLEASDVI
SPASVYVVKITGESKNYFFEFEEFNSTLPPPVIFKASYHGLYYIITLVVV
NGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVF
TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATF
NKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEE
SFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWPDFNSSDYETTSQPYWW
DSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWL
PPKPPTAFDGFHIHIEREENFTEYLMVDEEAHEFVAELKEPGKYKLSVTT
FSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQHVSVHVLSSTTAL
MSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKPIIENLV
PGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSW
TRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVRIANLLP
AWYYNFRVTMVTWGDPELSCCDSSTISFITAPVAPEITSVEYFNSLLYIS
WTYGDDTTDLSHSRMLHWMVVAEGKKKIKKSVTRNVMTAILSLPPGDIYN
LSVTACTERGSNTSMLRLVKLEPAPPKSLFAVNKTQTSVTLLWVEEGVAD
FFEVFCQQVGSSQKTKLQEPVAVSSHVVTISSLLPATAYNCSVTSFSHDS
PSVPTFIAVSTMVTEMNPNVVVISVLAILSTLLIGLLLVTLIILRKKHLQ
MARECGAGTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFY
INPWSKNGLKKRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGL
DIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPG
...
a.a.
length
InterPro Name
length(97), motif(22:118) 97 IPR008957 Fibronectin type III domain [Domain]
length(89), motif(27:115) 89 IPR003961 Fibronectin, type III [Domain]
length(89), motif(329:417) 89 IPR003961 Fibronectin, type III [Domain]
length(96), motif(431:526) 96 IPR008957 Fibronectin type III domain [Domain]
length(96), motif(432:527) 96 IPR003961 Fibronectin, type III [Domain]
length(94), motif(433:526) 94 IPR013783 Immunoglobulin-like fold [Domain]
length(86), motif(433:518) 86 IPR003961 Fibronectin, type III [Domain]
length(87), motif(435:521) 87 IPR003961 Fibronectin, type III [Domain]
length(107), motif(530:636) 107 IPR013783 Immunoglobulin-like fold [Domain]
length(102), motif(530:631) 102 IPR008957 Fibronectin type III domain [Domain]
length(101), motif(530:630) 101 IPR003961 Fibronectin, type III [Domain]
length(87), motif(530:616) 87 IPR003961 Fibronectin, type III [Domain]
length(82), motif(630:711) 82 IPR008957 Fibronectin type III domain [Domain]
length(90), motif(632:721) 90 IPR003961 Fibronectin, type III [Domain]
length(81), motif(632:712) 81 IPR003961 Fibronectin, type III [Domain]
length(89), motif(723:811) 89 IPR013783 Immunoglobulin-like fold [Domain]
length(90), motif(723:812) 90 IPR008957 Fibronectin type III domain [Domain]
length(89), motif(723:811) 89 IPR003961 Fibronectin, type III [Domain]
length(80), motif(723:802) 80 IPR003961 Fibronectin, type III [Domain]
length(76), motif(725:800) 76 IPR003961 Fibronectin, type III [Domain]
length(261), motif(937:1197) 261 IPR000242 Protein-tyrosine phosphatase, receptor/non-receptor type [Domain]
length(258), motif(938:1195) 258 IPR000242 Protein-tyrosine phosphatase, receptor/non-receptor type [Domain]
length(231), motif(962:1192) 231 IPR000242 Protein-tyrosine phosphatase, receptor/non-receptor type [Domain]
length(8), motif(991:998) 8 IPR000242 Protein-tyrosine phosphatase, receptor/non-receptor type [Domain]
length(21), motif(1007:1027) 21 IPR000242 Protein-tyrosine phosphatase, receptor/non-receptor type [Domain]
length(18), motif(1090:1107) 18 IPR000242 Protein-tyrosine phosphatase, receptor/non-receptor type [Domain]
length(104), motif(1091:1194) 104 IPR003595 Protein-tyrosine phosphatase, catalytic [Domain]
length(75), motif(1112:1186) 75 IPR000387 Dual-specific/protein-tyrosine phosphatase, conserved region [Domain]
length(19), motif(1131:1149) 19 IPR000242 Protein-tyrosine phosphatase, receptor/non-receptor type [Domain]
length(11), motif(1134:1144) 11 IPR016130 Protein-tyrosine phosphatase, active site [Active_site]
length(16), motif(1162:1177) 16 IPR000242 Protein-tyrosine phosphatase, receptor/non-receptor type [Domain]
length(11), motif(1178:1188) 11 IPR000242 Protein-tyrosine phosphatase, receptor/non-receptor type [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000388793
H-Inv cluster ID Locus viewHIX0026345
Accession number BC126201.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Receptor-type tyrosine-protein phosphatase O isoform a precursor.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_109592)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol PTPRO
HGNC aliases NA
HGNC name protein tyrosine phosphatase, receptor type, O
DDBJ PTPRO
UniProt NA
EC number EC 3.1.3.48protein-tyrosine-phosphatase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 04514 :Cell adhesion molecules (CAMs);  04520 :Adherens junction;  04630 :Jak-STAT signaling pathway;  04660 :T cell receptor signaling pathway;  04662 :B cell receptor signaling pathway;  04670 :Leukocyte transendothelial migration;  04910 :Insulin signaling pathway;  04920 :Adipocytokine signaling pathway;  04940 :Type I diabetes mellitus;  05120 :Epithelial cell signaling in Helicobacter pylori infection; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000056850
No. of interaction 2
Interaction partner(s) HIP000031963HIP000086920
BIND NA
DIP NA
MINT NA
HPRD 15467; 
IntAct EBI-3938084;  EBI-1389788; 
Database links RefSeq NM_002848NM_030667NM_030668NM_030669NM_030670NM_030671
Ensembl ENST00000281171ENST00000348962ENST00000442921ENST00000445537ENST00000535311ENST00000535322ENST00000538907ENST00000542557ENST00000543886ENST00000544244ENST00000544706ENST00000545023
Entrez Gene Entrez Gene ID:5800
KEGG GENES KEGG GENES(5800)
GeneCard GeneCardPTPRO*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function phosphoric monoester hydrolase activity (GO:0016791);  protein tyrosine phosphatase activity (GO:0004725); 
Biological process dephosphorylation (GO:0016311);  protein amino acid dephosphorylation (GO:0006470); 

Subcellular localization information  Last modified:20-Apr-2012
WoLF PSORT plasma membrane;  extracellular;  peroxisome;  Other; 
Target P signal peptide
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:20-Apr-2012
Start End PDB_ID E-value Identity Coverage SCOP_ID
436 530 1x5jA1 3e-09 15.8 95/100 b.1.2.1
518 635 1uemA 3e-06 17.8 107/117 b.1.2.1
630 710 1cfbA1 1e-04 14.5 81/100 b.1.2.1
925 1192 1jlnA 5e-64 40.8 260/297 c.45.1.2
Related H-InvDB links GTOP GTOP

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:20-Apr-2012
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  107920108600130080609113612372
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(5800)
Disease Entrez Gene ID:(5800)
Substance Entrez Gene ID:(5800)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Evolutionary information  Evola Help Last modified:20-Apr-2012
Relationship Species Accession number MGI Links
Orthology Mus sp. (Mouse) BC052743 MGI:1097152 G-integraG-integra
Orthology Equus sp. (Horse) ENSECAT00000017333 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000005141 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) GSTENT00011570001 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000167446 G-integraG-integra
Orthology Rattus sp. (Rat) U28938 G-integraG-integra
Orthology Gallus sp. (Chicken) U65891 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001367047 G-integraG-integra
Orthology Canis sp. (Dog) XM_543791 G-integraG-integra
Orthology Bos sp. (Cow) XM_614266 G-integraG-integra
Orthology Macaca sp. (Macaque) XR_011143 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XR_023379 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
271 .. 271 T/C rs112922378 + CDS Nonsynonymous[Val34Ala]
278 .. 278 T/C rs17762440 + CDS Synonymous[Asp36Asp]
815 .. 815 C/T rs112427744 + CDS Synonymous[Pro215Pro]
852 .. 852 A/G rs117540301 + CDS Nonsynonymous[Ile228Val]
1280 .. 1280 C/G rs61754411 + CDS Nonsynonymous[Asn370Lys]
1497 .. 1497 G/A rs71459181 + CDS Nonsynonymous[Val443Ile]
1614 .. 1614 G/T rs78433620 + CDS AA-STOP[Glu482*]
1742 .. 1742 G/A rs74073225 + CDS Synonymous[Val524Val]
1796 .. 1796 T/C rs1050646 + CDS Synonymous[Gly542Gly]
1853 .. 1853 C/T rs111913342 + CDS Synonymous[Tyr561Tyr]
2225 .. 2225 T/C rs71581909 + CDS Synonymous[Asn685Asn]
2258 .. 2258 C/A rs6488782 + CDS Synonymous[Gly696Gly]
2270 .. 2270 C/T rs80309166 + CDS Synonymous[Asn700Asn]
2426 .. 2426 T/C rs36020879 + CDS Synonymous[Phe752Phe]
2428 .. 2428 A/G rs80173106 + CDS Nonsynonymous[Glu753Gly]
2576 .. 2576 T/C rs61741744 + CDS Synonymous[Ser802Ser]
2892 .. 2892 G/T rs11056560 + CDS Nonsynonymous[Gly908Cys]
3011 .. 3011 G/A rs61754412 + CDS Synonymous[Leu947Leu]
3206 .. 3206 G/A rs3748299 + CDS Synonymous[Gly1012Gly]
3431 .. 3431 C/T rs77872564 + CDS Synonymous[Asp1087Asp]
3581 .. 3581 T/A rs4356288 + CDS Nonsynonymous[Ser1137Arg]
3633 .. 3633 C/G rs61757814 + CDS Nonsynonymous[His1155Asp]
3651 .. 3651 T/A rs3190975 + CDS Nonsynonymous[Phe1161Ile]
3892 .. 3892 C/G rs113024827 + 3'UTR
4192 .. 4192 G/A rs80301530 + 3'UTR
4262 .. 4262 C/G rs73305557 + 3'UTR
4545 .. 4545 G/T rs73305558 + 3'UTR
4673 .. 4673 C/G rs1802754 + 3'UTR
4706 .. 4706 A/G rs7306091 + 3'UTR
4746 .. 4746 T/G rs74476689 + 3'UTR
4748 .. 4748 A/G rs117346438 + 3'UTR
4835 .. 4835 T/C rs73305559 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer