H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000385386 Accession number: AM040517 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to Ig kappa chain V-IV region; Precursor; Fragment;
 
 

Transcript original information
Accession number AM040517.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 336[bp] (No. of exon:1)[A:86 T:76 G:81 C:93]
Devision HUM
Molecular type mRNA
Library origin Cell type B lymphocyte (malignant)
Tissue type lymph node
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N/C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0029781
Genomic location  G-integra Help Chromosome 2
Location 2p11.2
Position 89185367- 89185669
Strand +
Possible duplicated location(s) NA
Gene structure 1 exon(s)
Database links RefSeq NA
Ensembl ENST00000390243
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000175024
Predicted CDS 1..336;  112[aa];  Orientation:+1; 
Codon Adaptation Index (CAI).

Motif information
ORF

length(112),orf(1:336)
DIVMTQSPDSLAVSLGERATINCKSSQSLLYSTNNNNYLAWYQQKAGQPP
KLLIYWASTRASGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQNYTT
PSFGGGTKVEIK
a.a.
length
InterPro Name
length(95), motif(1:95) 95 IPR007110 Immunoglobulin-like [Domain]
length(109), motif(2:110) 109 IPR013106 Immunoglobulin V-set [Domain]
length(110), motif(3:112) 110 IPR013783 Immunoglobulin-like fold [Domain]
length(105), motif(8:112) 105 IPR003599 Immunoglobulin subtype [Domain]
length(79), motif(18:96) 79 IPR003596 Immunoglobulin V-set, subgroup [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000385386
H-Inv cluster ID Locus viewHIX0029781
Accession number AM040517.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Ig kappa chain V-IV region; Precursor; Fragment;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (P06312)  [Identity/coverage = 93.069%/83.47%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 2997712ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ IGKV
UniProt IGKV4-1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000175024
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl ENST00000390243
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT cytosol;  nuclear;  extracellular;  Other; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  600666607329609402
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name NA
Disease NA
Substance NA
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
26 .. 26 A/G rs116328981 + CDS Nonsynonymous[Asp9Gly]
40 .. 40 T/C rs72847567 + CDS Nonsynonymous[Ser14Pro]
88 .. 88 T/C rs72847569 + CDS Synonymous[Leu30Leu]
95 .. 95 G/A rs78280375 + CDS Nonsynonymous[Ser32Asn]
112 .. 112 T/A/C rs7606636 + CDS
153 .. 153 G/A rs115736498 + CDS Synonymous[Lys51Lys]
154 .. 154 C/T rs112784030 + CDS Synonymous[Leu52Leu]
230 .. 230 T/A rs72847570 + CDS Nonsynonymous[Phe77Tyr]
276 .. 276 T/C rs1141252 + CDS Synonymous[Tyr92Tyr]
278 .. 278 A/T rs1141253 + CDS Nonsynonymous[Tyr93Phe]
279 .. 279 C/T rs1134821 + CDS Synonymous[Tyr93Tyr]
288 .. 288 A/G rs111711225 + CDS Synonymous[Gln96Gln]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer