H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000340419 Accession number: BC112290 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Olfactory receptor 10J1; Olfactory receptor OR1-26; Olfactory receptor-like protein HGMP07J;
 
 

Transcript original information
Accession number BC112290.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:138495 IMAGE:8327758
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (OR10J1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (OR10J1);
Sequence data provider NA
Annotation project NA
Length of cDNA 1102[bp] (No. of exon:1)[A:259 T:330 G:228 C:285]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Cerebellum, Uterus, Testis, PCR rescued clones
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0028779
Genomic location  G-integra Help Chromosome 1
Location 1q23.2
Position 159409512- 159410601
Strand +
Possible duplicated location(s) NA
Gene structure 1 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:26476
KEGG GENES KEGG GENES(26476)
GeneCard GeneCardOR10J1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000073372
Predicted CDS 50..1012;  320[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.753

Motif information
ORF

length(320),orf(50:1012)
MLLCFRFGNQSMKRENFTLITDFVFQGFSSFHEQQITLFGVFLALYILTL
AGNIIIVTIIRIDLHLHTPMYFFLSMLSTSETVYTLVILPRMLSSLVGMS
QPMSLAGCATQMFFFVTFGITNCFLLTAMGYDRYVAICNPLRYMVIMNKR
LRIQLVLGACSIGLIVAITQVTSVFRLPFCARKVPHFFCDIRPVMKLSCI
DTTVNEILTLIISVLVLVVPMGLVFISYVLIISTILKIASVEGRKKAFAT
CASHLTVVIVHYSCASIAYLKPKSENTREHDQLISVTYTVITPLLNPVVY
TLRNKEVKDALCRAVGGKFS*
a.a.
length
InterPro Name
length(308), motif(9:316) 308 IPR017452 GPCR, rhodopsin-like, 7TM [Domain]
length(25), motif(37:61) 25 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(249), motif(52:300) 249 IPR017452 GPCR, rhodopsin-like, 7TM [Domain]
length(22), motif(70:91) 22 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(12), motif(103:114) 12 IPR000725 Olfactory receptor [Family]
length(23), motif(115:137) 23 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(17), motif(121:137) 17 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(13), motif(140:152) 13 IPR000725 Olfactory receptor [Family]
length(17), motif(186:202) 17 IPR000725 Olfactory receptor [Family]
length(24), motif(209:232) 24 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(10), motif(246:255) 10 IPR000725 Olfactory receptor [Family]
length(27), motif(282:308) 27 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(12), motif(293:304) 12 IPR000725 Olfactory receptor [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000340419
H-Inv cluster ID Locus viewHIX0028779
Accession number BC112290.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Olfactory receptor 10J1; Olfactory receptor OR1-26; Olfactory receptor-like protein HGMP07J;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P30954)  [Identity/coverage = 99.375%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Expression evidence
PubMed ID 137085912213199149830521548933416710414ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol OR10J1
HGNC aliases NA
HGNC name olfactory receptor, family 10, subfamily J, member 1
DDBJ OR10J1
UniProt OR10J1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000073372
No. of interaction 1
Interaction partner(s) HIP000039977
BIND NA
DIP 117371E; 
MINT NA
HPRD 03833; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:26476
KEGG GENES KEGG GENES(26476)
GeneCard GeneCardOR10J1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function olfactory receptor activity (GO:0004984);  G-protein coupled receptor activity (GO:0004930); 
Biological process G-protein coupled receptor protein signaling pathway (GO:0007186); 
Cellular component integral to membrane (GO:0016021); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT plasma membrane; 
Target P Not predicted
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL placenta/testis/ovary; 
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus 221346_at; 
HG-U133 221346_at; 
HG-U133A 221346_at; 
HG-U133A_2 221346_at; 
HG-U133B NA
HG-U133_Plus_2 221346_at; 
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2362568;  2362594;  2362595;  2362596;  2362597; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P397468; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P397468; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
13 .. 13 T/C rs200678837 + 5'UTR
34 .. 34 A/G rs10908721 + 5'UTR
113 .. 113 G/A rs62641745 + CDS Nonsynonymous[Asp22Asn]
150 .. 150 A/G rs200924583 + CDS Nonsynonymous[Gln34Arg]
152 .. 152 C/G/T rs138704767 + CDS
169 .. 169 C/A/T rs116409990 + CDS
170 .. 170 G/A rs116203586 + CDS Nonsynonymous[Val41Met]
175 ^ 176 -/C rs35762410 + CDS
205 .. 205 C/T rs146285820 + CDS Synonymous[Gly52Gly]
211 .. 211 C/A rs80068748 + CDS Synonymous[Ile54Ile]
217 .. 217 T/G rs112577371 + CDS Nonsynonymous[Ile56Met]
231 .. 231 G/A rs141763562 + CDS Nonsynonymous[Arg61Gln]
235 .. 235 T/G rs10908722 + CDS Nonsynonymous[Ile62Met]
237 .. 237 A/G rs200002931 + CDS Nonsynonymous[Asp63Gly]
258 .. 258 T/C rs35634161 + CDS Nonsynonymous[Met70Thr]
260 .. 260 T/C rs116161672 + CDS Nonsynonymous[Tyr71His]
298 .. 298 A/C rs145304434 + CDS Synonymous[Val83Val]
299 .. 299 T/A rs116754841 + CDS Nonsynonymous[Tyr84Asn]
325 .. 325 G/C rs201195973 + CDS Nonsynonymous[Met92Ile]
339 .. 339 T/G rs201658172 + CDS Nonsynonymous[Val97Gly]
358 .. 358 G/A rs12048482 + CDS Nonsynonymous[Met103Ile]
367 .. 367 A/T rs140782298 + CDS Synonymous[Ala106Ala]
385 .. 385 G/A rs12118628 + CDS Nonsynonymous[Met112Ile]
396 .. 396 T/C rs138020603 + CDS Nonsynonymous[Val116Ala]
411 .. 411 C/T rs76241483 + CDS Nonsynonymous[Thr121Ile]
427 .. 427 C/G rs199938422 + CDS Synonymous[Leu126Leu]
435 .. 435 T/C rs200416739 + CDS Nonsynonymous[Met129Thr]
466 .. 466 C/T rs12070985 + CDS Synonymous[Asn139Asn]
480 .. 480 T/G rs74564875 + CDS Nonsynonymous[Met144Arg]
503 .. 503 C/A rs139843472 + CDS Nonsynonymous[Arg152Ser]
504 .. 504 G/A rs202246787 + CDS Nonsynonymous[Arg152His]
507 .. 507 T/C rs181042173 + CDS Nonsynonymous[Ile153Thr]
508 .. 508 C/T rs76488331 + CDS Synonymous[Ile153Ile]
538 .. 538 G/A rs185879913 + CDS Synonymous[Gly163Gly]
556 .. 556 G/A rs149860482 + CDS Synonymous[Thr169Thr]
569 .. 569 G/C rs143179434 + CDS Nonsynonymous[Val174Leu]
594 .. 594 G/A rs188785669 + CDS Nonsynonymous[Arg182Lys]
604 .. 604 C/G rs62641747 + CDS Synonymous[Pro185Pro]
623 .. 623 C/T rs143481177 + CDS Nonsynonymous[Arg192Cys]
663 .. 663 A/G rs140818033 + CDS Nonsynonymous[Asn205Ser]
684 .. 684 T/A rs200283580 + CDS Nonsynonymous[Ile212Asn]
707 .. 707 C/A rs199560609 + CDS Nonsynonymous[Pro220Thr]
718 .. 718 G/A rs41264477 + CDS Synonymous[Leu223Leu]
781 .. 781 G/A rs201945361 + CDS Synonymous[Arg244Arg]
784 .. 784 G/A rs147037013 + CDS Synonymous[Lys245Lys]
841 .. 841 T/A rs12409540 + CDS AA-STOP[Cys264*]
843 .. 843 C/T rs148777598 + CDS Nonsynonymous[Ala265Val]
855 .. 855 A/T rs41264479 + CDS Nonsynonymous[Tyr269Phe]
879 .. 879 C/A rs200773376 + CDS Nonsynonymous[Thr277Asn]
895 .. 895 G/A rs199959856 + CDS Synonymous[Gln282Gln]
903 .. 903 C/T rs144480627 + CDS Nonsynonymous[Ser285Leu]
905 .. 905 G/A rs201823824 + CDS Nonsynonymous[Val286Met]
921 .. 921 T/C rs201898028 + CDS Nonsynonymous[Ile291Thr]
932 .. 932 C/T rs139080966 + CDS Synonymous[Leu295Leu]
996 .. 996 G/A/T rs200953384 + CDS
1018 .. 1018 T/C rs199724526 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer