H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000336350 Accession number: BC100936 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Mitochondrial ornithine transporter 2.
 
 

Motif information
ORF

length(301),orf(1:906)
MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDC
FLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDK
QAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQTMYEMEMSGKIAKSH
NTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFFFGGYELSRSFFAS
GRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVLSMYGKQAGFI
GTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEA
Y*
a.a.
length
InterPro Name
length(286), motif(4:289) 286 IPR001993 Mitochondrial substrate carrier [Family]
length(85), motif(7:91) 85 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(294), motif(8:301) 294 IPR001993 Mitochondrial substrate carrier [Family]
length(85), motif(10:94) 85 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(94), motif(104:197) 94 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(93), motif(107:199) 93 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(92), motif(206:297) 92 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(87), motif(207:293) 87 IPR018108 Mitochondrial substrate/solute carrier [Repeat]