H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000336350 Accession number: BC100936 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Mitochondrial ornithine transporter 2; Solute carrier family 25 member 2;
 
 

Motif information
ORF

length(301),orf(1:906)
MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDC
FLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDK
QAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQTMYEMEMSGKIAKSH
NTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFFFGGYELSRSFFAS
GRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVLSMYGKQAGFI
GTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEA
Y*
a.a.
length
InterPro Name
length(283), motif(7:289) 283 IPR023395 Mitochondrial carrier domain [Domain]
length(85), motif(7:91) 85 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(286), motif(8:293) 286 IPR023395 Mitochondrial carrier domain [Domain]
length(85), motif(10:94) 85 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(94), motif(104:197) 94 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(94), motif(106:199) 94 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(92), motif(206:297) 92 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(87), motif(207:293) 87 IPR018108 Mitochondrial substrate/solute carrier [Repeat]