H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000336350 Accession number: BC100936 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Mitochondrial ornithine transporter 2; Solute carrier family 25 member 2;
 
 

Transcript original information
Accession number BC100936.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:119152 IMAGE:40004046
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (SLC25A2) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (SLC25A2);
Sequence data provider NA
Annotation project NA
Length of cDNA 956[bp] (No. of exon:1)[A:230 T:246 G:263 C:217]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type PCR rescued clones
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0031997
Genomic location  G-integra Help Chromosome 5
Location 5q31.3
Position 140682477- 140683432
Strand -
Possible duplicated location(s) NA
Gene structure 1 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:83884
KEGG GENES KEGG GENES(83884)
GeneCard GeneCardSLC25A2*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000069782
Predicted CDS 1..906;  301[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.72
Database links RefSeq NP_114153
UniProt Q9BXI2
CCDS CCDS4258

Motif information
ORF

length(301),orf(1:906)
MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDC
FLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDK
QAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQTMYEMEMSGKIAKSH
NTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFFFGGYELSRSFFAS
GRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVLSMYGKQAGFI
GTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEA
Y*
a.a.
length
InterPro Name
length(283), motif(7:289) 283 IPR023395 Mitochondrial carrier domain [Domain]
length(85), motif(7:91) 85 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(286), motif(8:293) 286 IPR023395 Mitochondrial carrier domain [Domain]
length(85), motif(10:94) 85 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(94), motif(104:197) 94 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(94), motif(106:199) 94 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(92), motif(206:297) 92 IPR018108 Mitochondrial substrate/solute carrier [Repeat]
length(87), motif(207:293) 87 IPR018108 Mitochondrial substrate/solute carrier [Repeat]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000336350
H-Inv cluster ID Locus viewHIX0031997
Accession number BC100936.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Mitochondrial ornithine transporter 2; Solute carrier family 25 member 2;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q9BXI2)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 112301631294874115489334ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol SLC25A2
HGNC aliases NA
HGNC name solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 2
DDBJ SLC25A2
UniProt SLC25A2
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000069782
No. of interaction 22
Interaction partner(s) HIP000034130HIP000034709HIP000046840HIP000071011HIP000085125HIP000085125HIP000087949HIP000088916HIP000095929HIP000098568HIP000102384HIP000111022HIP000114715HIP000146054HIP000148859HIP000163436HIP000163436HIP000181513HIP000258560HIP000336703HIP000336703HIP000339211
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:83884
KEGG GENES KEGG GENES(83884)
GeneCard GeneCardSLC25A2*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  extracellular;  mitochondria;  plasma membrane;  Other; 
Target P Other
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
7 198 1okcA 1e-29 17.5 219/292 f.42.1.1
259 289 1okcA 1e-29 17.5 219/292 f.42.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL placenta/testis/ovary; 
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 224166_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 224166_at; 
HG-U133_Plus_2 224166_at; 
HG-U95 57269_at; 
HG-U95A NA
HG-U95B 57269_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2878632;  2878633; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
24 .. 24 A/G rs144025383 - CDS Synonymous[Gln8Gln]
56 .. 56 G/C rs201461973 - CDS Nonsynonymous[Gly19Ala]
113 .. 113 A/C rs200019700 - CDS Nonsynonymous[Gln38Pro]
168 .. 168 T/C rs11952797 - CDS Synonymous[Ala56Ala]
191 .. 191 A/G rs115876844 - CDS Nonsynonymous[Tyr64Cys]
194 .. 194 A/G rs149669559 - CDS Nonsynonymous[Lys65Arg]
266 .. 266 A/G rs139485114 - CDS Nonsynonymous[Gln89Arg]
286 .. 286 G/T rs150904237 - CDS Nonsynonymous[Ala96Ser]
331 .. 331 G/A rs201288464 - CDS Nonsynonymous[Ala111Thr]
336 .. 336 G/T rs142472222 - CDS Synonymous[Ala112Ala]
352 .. 352 G/A rs140903972 - CDS Nonsynonymous[Ala118Thr]
410 .. 410 T/C rs143476554 - CDS Nonsynonymous[Met137Thr]
413 .. 413 A/G rs199979167 - CDS Nonsynonymous[Tyr138Cys]
440 .. 440 C/T rs34663948 + CDS Nonsynonymous[Ala147Val]
475 .. 475 G/T rs10075302 - CDS Nonsynonymous[Gly159Cys]
540 .. 540 A/G rs199552235 - CDS Synonymous[Glu180Glu]
542 .. 542 T/G rs3749779 + CDS Nonsynonymous[Val181Gly]
545 .. 545 C/T rs149349247 - CDS Nonsynonymous[Pro182Leu]
646 .. 646 G/A rs137959840 - CDS Nonsynonymous[Gly216Ser]
651 .. 651 A/C rs150162255 - CDS Synonymous[Gly217Gly]
657 .. 657 T/C rs141132745 - CDS Synonymous[Ala219Ala]
676 .. 676 G/A/T rs3749780 + CDS
689 .. 689 T/A rs200925434 - CDS Nonsynonymous[Val230Glu]
715 .. 715 G/A rs145456969 - CDS Nonsynonymous[Val239Ile]
722 .. 722 C/G rs146929069 - CDS Nonsynonymous[Ser241Cys]
735 .. 735 A/G rs189382434 - CDS Synonymous[Lys245Lys]
759 .. 759 C/T rs3749781 + CDS Synonymous[Leu253Leu]
778 .. 778 G/T rs201027777 - CDS AA-STOP[Glu260*]
847 .. 847 C/T rs183485813 - CDS Synonymous[Leu283Leu]
879 .. 879 G/A rs200365489 - CDS Nonsynonymous[Met293Ile]
886 .. 886 A/G rs201821285 - CDS Nonsynonymous[Lys296Glu]
890 .. 890 A/G rs200557097 - CDS Nonsynonymous[Gln297Arg]
900 .. 900 A/G rs140268129 - CDS Synonymous[Ala300Ala]
930 .. 930 G/A rs201849925 - 3'UTR
950 .. 950 T/A rs180852440 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer