H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000336226 Accession number: BC100799 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Transcription cofactor vestigial-like protein 2 isoform 2.
 
 

Motif information
ORF

length(143),orf(174:605)
MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGS
GSSSFSSQTPASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVD
EHFSRALSQPSSYSPSCTSSKAPRSSGPWRARRYSLCGASLLS*
a.a.
length
InterPro Name
length(33), motif(79:111) 33 IPR011520 Vestigial/tondu [Family]
length(16), motif(96:111) 16 IPR006627 TDU repeat [Repeat]