H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000334151 Accession number: BC069015 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Ig kappa chain C region;
 
 

Motif information
ORF

length(236),orf(18:728)
MDMRVPAQLLGLLLLWLPGARCAIQLTQSPSSLSASVGDRVTITCRASQG
ISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSL
QPEDFATYYCQQFNNYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSG
TASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST
LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC*
a.a.
length
InterPro Name
length(117), motif(11:127) 117 IPR013783 Immunoglobulin-like fold [Domain]
length(116), motif(18:133) 116 IPR007110 Immunoglobulin-like domain [Domain]
length(104), motif(24:127) 104 IPR013106 Immunoglobulin V-set domain [Domain]
length(103), motif(130:232) 103 IPR013783 Immunoglobulin-like fold [Domain]
length(98), motif(135:232) 98 IPR007110 Immunoglobulin-like domain [Domain]
length(87), motif(141:227) 87 IPR003597 Immunoglobulin C1-set [Domain]
length(76), motif(151:226) 76 IPR003597 Immunoglobulin C1-set [Domain]
length(7), motif(214:220) 7 IPR003006 Immunoglobulin/major histocompatibility complex, conserved site [Conserved_site]