H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000326949 Accession number: Z33642 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Immunoglobulin superfamily member 2; IgSF2; Cell surface glycoprotein V7; Glu-Trp-Ile EWI motif-containing protein 101; EWI-101; AltName: CD_antigen=CD101; Precursor;
 
 

Transcript original information
Accession number Z33642.1
CAGE tag ID NA
EST ID NA
Clone Number V7
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (CD101) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (CD101);
Sequence data provider NA
Annotation project NA
Length of cDNA 3340[bp] (No. of exon:10)[A:894 T:758 G:850 C:838]
Devision HUM
Molecular type mRNA
Library origin Cell type CD8+ T cell clone
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0028852
Genomic location  G-integra Help Chromosome 1
Location 1p13.1
Position 117544434- 117579039
Strand +
Possible duplicated location(s) NA
Gene structure 10 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:9398
KEGG GENES KEGG GENES(9398)
GeneCard GeneCardCD101*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000027421
Predicted CDS 22..3087;  1021[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.761

Motif information
ORF

length(1021),orf(22:3087)
MAGISYVASFFLLLTKLSIGQREVTVQKGPLFRAEGYPVSIGCNVTGHQG
PSEQHFQWSVYLPTNPTQEVQIISTKDAAFSYAVYTQRVRGGDVYVERVQ
GNSVLLHISKLQMKDAGEYECHTPNTDENYYGSYRAKTNLIVIPDTLSAT
MSSQTLGKEEGEPLALTCEASKATAQHTHLSVTWYLTQDGGGSQATEIIS
LSKDFILVPGPLYTERFAASDVQLNKLGPTTFRLSIERLQSSDQGQLFCE
ATEWIQDPDETWMFITKKQTDQTTLRIQPAVKDFQVNITADSLFAEGKPL
ELVCLVVSSGRDPQLQGIWFFNGTEIAHIDAGGVLGLKNDYKERASQGEL
QLSKLGPKAFSLKIFSLGPEDEGAYRCVVAEVMKTRTGSWQVLQRKQSPD
SHVHLRKPAARSVVVSTKNKQQVVWEGETLAFLCKAGGAESPLSVSWWHI
PRDQTQPEFVAGMGQDGIVQLGASYGVPSYHGNTRLEKMDWATFQLEITF
TAITDSGTYECRVSEKSRNQARDLSWTQKISVTVKSLESSLQVSLMSRQP
QVMLTNTFDLSCVVRAGYSDLKVPLTVTWQFQPASSHIFHQLIRITHNGT
IEWGNFLSRFQKKTKVSQSLFRSQLLVHDATEEETGVYQCEVEVYDRNSL
YNNRPPRASAISHPLRIAVTLPESKLKVNSRSQGQELSINSNTDIECSIL
SRSNGNLQLAIIWYFSPVSTNASWLKILEMDQTNVIKTGDEFHTPQRKQK
FHTEKVSQDLFQLHILNVEDSDRGKYHCAVEEWLLSTNGTWHKLGEKKSG
LTELKLKPTGSKVRVSKVYWTENVTEHREVAIRCSLESVGSSATLYSVMW
YWNRENSGSKLLVHLQHDGLLEYGEEGLRRHLHCYRSSSTDFVLKLHQVE
MEDAGMYWCRVAEWQLHGHPSKWINQASDESQRMVLTVLPSEPTLPSRIC
SSAPLLYFLFICPFVLLLLLLISLLCLYWKARKLSTLRSNTRKEKALWVD
...
a.a.
length
InterPro Name
length(140), motif(23:162) 140 IPR013783 Immunoglobulin-like fold [Domain]
length(120), motif(23:142) 120 IPR013106 Immunoglobulin V-set domain [Domain]
length(116), motif(28:143) 116 IPR003599 Immunoglobulin subtype [Domain]
length(105), motif(35:139) 105 IPR007110 Immunoglobulin-like domain [Domain]
length(109), motif(144:252) 109 IPR007110 Immunoglobulin-like domain [Domain]
length(126), motif(153:278) 126 IPR003599 Immunoglobulin subtype [Domain]
length(99), motif(154:252) 99 IPR013106 Immunoglobulin V-set domain [Domain]
length(118), motif(163:280) 118 IPR013783 Immunoglobulin-like fold [Domain]
length(111), motif(279:389) 111 IPR007110 Immunoglobulin-like domain [Domain]
length(107), motif(289:395) 107 IPR003599 Immunoglobulin subtype [Domain]
length(99), motif(294:392) 99 IPR013783 Immunoglobulin-like fold [Domain]
length(9), motif(400:408) 9 IPR002195 Dihydroorotase, conserved site [Conserved_site]
length(118), motif(408:525) 118 IPR007110 Immunoglobulin-like domain [Domain]
length(142), motif(414:555) 142 IPR013783 Immunoglobulin-like fold [Domain]
length(107), motif(414:520) 107 IPR013098 Immunoglobulin I-set [Domain]
length(117), motif(419:535) 117 IPR003599 Immunoglobulin subtype [Domain]
length(124), motif(547:670) 124 IPR003599 Immunoglobulin subtype [Domain]
length(88), motif(556:643) 88 IPR013783 Immunoglobulin-like fold [Domain]
length(92), motif(560:651) 92 IPR007110 Immunoglobulin-like domain [Domain]
length(126), motif(656:781) 126 IPR007110 Immunoglobulin-like domain [Domain]
length(118), motif(675:792) 118 IPR013783 Immunoglobulin-like fold [Domain]
length(126), motif(682:807) 126 IPR003599 Immunoglobulin subtype [Domain]
length(94), motif(689:782) 94 IPR013106 Immunoglobulin V-set domain [Domain]
length(104), motif(808:911) 104 IPR007110 Immunoglobulin-like domain [Domain]
length(120), motif(820:939) 120 IPR003599 Immunoglobulin subtype [Domain]
length(121), motif(823:943) 121 IPR013783 Immunoglobulin-like fold [Domain]
length(90), motif(823:912) 90 IPR013106 Immunoglobulin V-set domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000326949
H-Inv cluster ID Locus viewHIX0028852
Accession number Z33642.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Immunoglobulin superfamily member 2; IgSF2; Cell surface glycoprotein V7; Glu-Trp-Ile EWI motif-containing protein 101; EWI-101; AltName: CD_antigen=CD101; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q93033)  [Identity/coverage = 99.412%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 772229977223009233604938931796472261069202511093127115047381573721316710414ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol CD101
HGNC aliases "immunoglobulin superfamily, member 2"
HGNC name CD101 molecule
DDBJ V7
UniProt CD101
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000027421
No. of interaction 6
Interaction partner(s) HIP000057867HIP000061486HIP000076386HIP000104855HIP000141598HIP000141598
BIND NA
DIP NA
MINT MINT-65086;  MINT-65087;  MINT-65088;  MINT-65089; 
HPRD 02948;  04528;  08426;  18051; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:9398
KEGG GENES KEGG GENES(9398)
GeneCard GeneCardCD101*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides (GO:0016812);  protein binding (GO:0005515); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT peroxisome;  plasma membrane;  extracellular;  Other; 
Target P signal peptide
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
23 143 1eajA 3e-11 17.1 117/124 b.1.1.1
152 267 1od7A 5e-05 15.5 108/118 b.1.1.1
296 379 1q8mA 8e-05 15.5 83/121 b.1.1.1
417 534 1hkfA 2e-08 18.7 107/108 b.1.1.1
560 643 2atpB1 1e-04 11.9 82/115 b.1.1.1
724 792 1npuA 9e-04 13.0 69/116 b.1.1.1
830 940 1q8mA 9e-10 16.2 99/121 b.1.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA241324; 
Affymetrix
GeneChip
HG-Focus 207167_at; 
HG-U133 207167_at; 
HG-U133A 207167_at; 
HG-U133A_2 207167_at; 
HG-U133B NA
HG-U133_Plus_2 207167_at; 
HG-U95 33983_at; 
HG-U95A 33983_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2353750;  2353751;  2353752;  2353753;  2353754;  2353756;  2353757;  2353765;  2353766;  2353767;  2353772;  2430100;  2430102; 
HuGeneFL Z33642_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P126353; 
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
122 .. 122 C/G rs201203459 + CDS Nonsynonymous[Ala34Gly]
143 .. 143 T/C rs140285627 + CDS Nonsynonymous[Ile41Thr]
153 .. 153 T/C rs7554376 + CDS Synonymous[Asn44Asn]
172 .. 172 C/T rs138818196 + CDS Nonsynonymous[Pro51Ser]
185 .. 185 A/T rs200356812 + CDS Nonsynonymous[His55Leu]
219 .. 219 G/A rs202159117 + CDS Synonymous[Pro66Pro]
230 .. 230 T/A rs140567712 + CDS Nonsynonymous[Val70Asp]
232 .. 232 C/T rs199570107 + CDS AA-STOP[Gln71*]
268 .. 268 G/A rs201531719 + CDS Nonsynonymous[Ala83Thr]
289 .. 289 C/A rs148124881 + CDS Synonymous[Arg90Arg]
300 .. 300 C/T rs139310374 + CDS Synonymous[Asp93Asp]
320 .. 320 A/G rs138899446 + CDS Nonsynonymous[Gln100Arg]
323 .. 323 G/A rs144242870 + CDS Nonsynonymous[Gly101Asp]
379 .. 379 G/A rs148436573 + CDS Nonsynonymous[Glu120Lys]
398 .. 398 C/A rs150988152 + CDS Nonsynonymous[Thr126Asn]
413 .. 413 A/G rs141072919 + CDS Nonsynonymous[Tyr131Cys]
420 .. 420 T/G rs140502844 + CDS Nonsynonymous[Ser133Arg]
459 .. 459 C/G rs143319357 + CDS Synonymous[Thr146Thr]
490 .. 490 G/A rs34999087 + CDS Nonsynonymous[Gly157Ser]
583 .. 583 C/G rs185581486 + CDS Nonsynonymous[Gln188Glu]
586 .. 586 G/A rs35653862 + CDS Nonsynonymous[Asp189Asn]
626 .. 626 C/T rs41276560 + CDS Nonsynonymous[Ser202Phe]
668 .. 668 G/A rs34397029 + CDS Nonsynonymous[Arg216Gln]
684 .. 684 C/T rs150724602 + CDS Synonymous[Asp221Asp]
685 .. 685 G/A rs117050713 + CDS Nonsynonymous[Val222Ile]
695 .. 695 A/G rs3754112 - CDS Nonsynonymous[Asn225Ser]
704 .. 704 G/T rs143423094 + CDS Nonsynonymous[Gly228Val]
748 .. 748 G/C rs146752093 + CDS Nonsynonymous[Asp243His]
766 .. 766 T/C rs199706531 + CDS Nonsynonymous[Cys249Arg]
771 .. 771 G/A rs142770876 + CDS Synonymous[Glu250Glu]
776 .. 776 C/T rs150553337 + CDS Nonsynonymous[Thr252Met]
794 .. 794 C/T rs200728594 + CDS Nonsynonymous[Pro258Leu]
818 .. 818 C/T rs150217954 + CDS Nonsynonymous[Thr266Ile]
881 .. 881 A/G rs141733979 + CDS Nonsynonymous[Asn287Ser]
928 .. 928 G/A rs201304832 + CDS Nonsynonymous[Val303Ile]
960 .. 960 A/G rs147095176 + CDS Synonymous[Pro313Pro]
1000 .. 1000 G/A rs17235752 + CDS Nonsynonymous[Ala327Thr]
1059 .. 1059 T/A rs201248748 + CDS Nonsynonymous[Ser346Arg]
1064 .. 1064 G/A rs144225932 + CDS Nonsynonymous[Gly348Glu]
1106 .. 1106 T/C rs34814219 + CDS Nonsynonymous[Leu362Pro]
1137 .. 1137 A/G rs146552866 + CDS Synonymous[Glu372Glu]
1140 .. 1140 C/T rs145967061 + CDS Synonymous[Gly373Gly]
1142 .. 1142 C/T rs141390223 + CDS Nonsynonymous[Ala374Val]
1188 .. 1188 C/T rs74876983 + CDS Synonymous[Ser389Ser]
1205 .. 1205 G/A rs148714384 + CDS Nonsynonymous[Arg395Lys]
1219 .. 1219 G/C rs147897391 + CDS Nonsynonymous[Asp400His]
1227 .. 1227 C/T rs147079394 + CDS Synonymous[His402His]
1228 .. 1228 G/A rs41276562 + CDS Nonsynonymous[Val403Met]
1243 .. 1243 C/T rs142901236 + CDS Nonsynonymous[Pro408Ser]
1259 .. 1259 T/C rs139692289 + CDS Nonsynonymous[Val413Ala]
1263 .. 1263 C/T rs202082942 + CDS Synonymous[Val414Val]
1264 .. 1264 G/A rs2249265 - CDS Nonsynonymous[Val415Met]
1269 .. 1269 T/C rs201588674 + CDS Synonymous[Ser416Ser]
1320 .. 1320 C/T rs80284023 + CDS Synonymous[Leu433Leu]
1325 ^ 1326 -/G rs34534462 + CDS
1327 .. 1327 G/T rs138571018 + CDS Nonsynonymous[Ala436Ser]
1353 .. 1353 T/A rs149850782 + CDS Synonymous[Ser444Ser]
1375 .. 1375 C/T rs146228310 + CDS Nonsynonymous[Arg452Trp]
1376 .. 1376 G/A rs183186729 + CDS Nonsynonymous[Arg452Gln]
1377 .. 1377 G/T rs150584407 + CDS Synonymous[Arg452Arg]
1392 .. 1392 C/T rs139644223 + CDS Synonymous[Pro457Pro]
1405 .. 1405 G/T rs147461272 + CDS Nonsynonymous[Gly462Cys]
1422 .. 1422 C/T rs145887018 + CDS Synonymous[Gly467Gly]
1426 .. 1426 G/T rs201411736 + CDS Nonsynonymous[Val469Leu]
1431 .. 1431 G/T rs148555610 + CDS Nonsynonymous[Gln470His]
1479 .. 1479 G/A rs140626844 + CDS Synonymous[Leu486Leu]
1484 ^ 1485 -/TGG rs201144179 + CDS
1541 .. 1541 G/A rs138533743 + CDS Nonsynonymous[Gly507Asp]
1574 .. 1574 G/A rs17235766 + CDS Nonsynonymous[Arg518Gln]
1596 .. 1596 C/G rs17235773 + CDS Nonsynonymous[Ser525Arg]
1635 .. 1635 G/A rs192424330 + CDS Synonymous[Glu538Glu]
1674 .. 1674 G/A rs3736908 - CDS Synonymous[Gln551Gln]
1686 .. 1686 C/T rs142902665 + CDS Synonymous[Thr555Thr]
1687 .. 1687 A/G rs145387761 + CDS Nonsynonymous[Asn556Asp]
1692 .. 1692 C/A rs78477372 + CDS Synonymous[Thr557Thr]
1719 .. 1719 C/T rs12059596 + CDS Synonymous[Ala566Ala]
1754 .. 1754 C/T rs201016506 + CDS Nonsynonymous[Thr578Met]
1760 .. 1760 A/G rs41276564 + CDS Nonsynonymous[Gln580Arg]
1783 .. 1783 A/G rs200268262 + CDS Nonsynonymous[Ile588Val]
1785 .. 1785 A/C rs3736907 - CDS Synonymous[Ile588Ile]
1801 .. 1801 C/G rs140225271 + CDS Nonsynonymous[Arg594Gly]
1802 .. 1802 G/A rs199631117 + CDS Nonsynonymous[Arg594Gln]
1846 .. 1846 C/T rs147999806 + CDS Nonsynonymous[Arg609Trp]
1853 .. 1853 A/- rs35845264 + CDS
1863 .. 1863 G/A rs79996128 + CDS Synonymous[Thr614Thr]
1871 .. 1871 C/T rs200402907 + CDS Nonsynonymous[Ser617Leu]
1886 .. 1886 G/A rs116063197 + CDS Nonsynonymous[Arg622His]
1905 .. 1905 T/C rs202136553 + CDS Synonymous[His628His]
1913 .. 1913 C/G rs34510762 + CDS Nonsynonymous[Thr631Ser]
1972 .. 1972 T/G rs34882009 + CDS Nonsynonymous[Tyr651Asp]
2052 .. 2052 A/G rs186468826 + CDS Synonymous[Lys677Lys]
2125 .. 2125 C/T rs142818844 + CDS Nonsynonymous[Arg702Trp]
2132 .. 2132 A/G rs141474998 + CDS Nonsynonymous[Asn704Ser]
2159 .. 2159 G/A rs201463000 + CDS AA-STOP[Trp713*]
2169 .. 2169 T/C rs150866268 + CDS Synonymous[Ser716Ser]
2248 .. 2248 C/T rs201701671 + CDS Nonsynonymous[His743Tyr]
2260 .. 2260 A/G rs146628892 + CDS Nonsynonymous[Arg747Gly]
2297 .. 2297 A/T rs199628070 + CDS Nonsynonymous[Asp759Val]
2305 .. 2305 C/T rs149868866 + CDS AA-STOP[Gln762*]
2335 .. 2335 G/A rs200228819 + CDS Nonsynonymous[Asp772Asn]
2360 .. 2360 T/C rs201597764 + CDS Nonsynonymous[Val780Ala]
2383 .. 2383 A/G rs144897714 + CDS Nonsynonymous[Asn788Asp]
2388 .. 2388 C/T rs147808609 + CDS Synonymous[Gly789Gly]
2394 .. 2394 G/C rs146991395 + CDS Nonsynonymous[Trp791Cys]
2477 .. 2477 A/G rs151146616 + CDS Nonsynonymous[Tyr819Cys]
2480 .. 2480 G/C rs200535830 + CDS Nonsynonymous[Trp820Ser]
2505 .. 2505 A/G rs186703902 + CDS Synonymous[Arg828Arg]
2519 .. 2519 G/A rs2274254 - CDS Nonsynonymous[Arg833His]
2521 .. 2521 T/C rs200190850 + CDS Nonsynonymous[Cys834Arg]
2531 .. 2531 A/G rs138724623 + CDS Nonsynonymous[Glu837Gly]
2536 .. 2536 G/A rs17229382 + CDS Nonsynonymous[Val839Ile]
2591 .. 2591 C/T rs150961244 + CDS Nonsynonymous[Ser857Phe]
2677 .. 2677 C/T rs145563609 + CDS Nonsynonymous[Arg886Cys]
2680 .. 2680 T/C rs201768380 + CDS Nonsynonymous[Ser887Pro]
2736 .. 2736 A/T rs140160363 + CDS Synonymous[Gly905Gly]
2819 .. 2819 G/A/T rs12093834 + CDS
2829 .. 2829 C/A rs138020050 + CDS Synonymous[Leu936Leu]
2833 .. 2833 G/A rs142603483 + CDS Nonsynonymous[Val938Met]
2853 .. 2853 G/A rs76030562 + CDS Synonymous[Thr944Thr]
2883 .. 2883 T/A rs201085670 + CDS Synonymous[Pro954Pro]
2886 .. 2886 A/T rs34223095 + CDS Nonsynonymous[Leu955Phe]
2891 .. 2891 A/G rs199968696 + CDS Nonsynonymous[Tyr957Cys]
2908 .. 2908 C/G rs199980381 + CDS Nonsynonymous[Pro963Ala]
2914 .. 2914 G/A rs12097758 + CDS Nonsynonymous[Val965Ile]
2917 .. 2917 C/G rs143185342 + CDS Nonsynonymous[Leu966Val]
2934 .. 2934 C/T rs141401897 + CDS Synonymous[Leu971Leu]
2976 .. 2976 A/G rs34512192 + CDS Synonymous[Ser985Ser]
2983 .. 2983 C/T rs12067543 + CDS Nonsynonymous[Arg988Cys]
2995 .. 2995 C/T rs34248572 + CDS Nonsynonymous[Arg992Trp]
3041 .. 3041 T/C rs200874222 + CDS Nonsynonymous[Val1007Ala]
3043 .. 3043 A/G rs150494742 + CDS Nonsynonymous[Thr1008Ala]
3061 .. 3061 G/C rs139509193 + CDS Nonsynonymous[Asp1014His]
3063 .. 3063 C/T rs201188703 + CDS Synonymous[Asp1014Asp]
3069 .. 3069 G/A rs202074442 + CDS Synonymous[Glu1016Glu]
3090 .. 3090 C/A rs112438489 + 3'UTR
3099 .. 3099 C/T rs111277178 + 3'UTR
3114 ^ 3115 -/G rs34169609 + 3'UTR
3231 ^ 3232 -/C rs71096895 + 3'UTR
3263 .. 3263 C/A rs1049182 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
LTR72 3118 3339 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer