H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000326127 Accession number: Z11179 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to T-cell receptor gamma chain C region 1;
 
 

Transcript original information
Accession number Z11179.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 222[bp] (No. of exon:3)[A:73 T:55 G:38 C:56]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N/C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0006611
Genomic location  G-integra Help Chromosome 7
Location 7p14.1
Position 38289105- 38356709
Strand -
Possible duplicated location(s) NA
Gene structure 3 exon(s)
Database links RefSeq NM_001003799NM_001003806
Ensembl ENST00000390333ENST00000390334ENST00000390337ENST00000390338ENST00000390339ENST00000390340ENST00000390341ENST00000390343ENST00000390344ENST00000390345ENST00000390346ENST00000419915ENST00000422161ENST00000426039ENST00000426402ENST00000427089ENST00000436911ENST00000443402ENST00000444775
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000124525
Predicted CDS 3..222;  73[aa];  Orientation:+3; 
Codon Adaptation Index (CAI).

Motif information
ORF

length(73),orf(3:222)
RIPETSTTTLTIHNVEKQDIATYYCALWERPQELGKKIKVFGPGTKLIIT
DKQLDADVSPKPTIFLPSIAETK
a.a.
length
InterPro Name
length(47), motif(4:50) 47 IPR013783 Immunoglobulin-like fold [Domain]
length(44), motif(5:48) 44 IPR013106 Immunoglobulin V-set [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000326127
H-Inv cluster ID Locus viewHIX0006611
Accession number Z11179.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to T-cell receptor gamma chain C region 1;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (P0CF51)  [Identity/coverage = 100.0%/13.29%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 2879283ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ NA
UniProt TRGC1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000124525
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NM_001003799NM_001003806
Ensembl ENST00000390333ENST00000390334ENST00000390337ENST00000390338ENST00000390339ENST00000390340ENST00000390341ENST00000390343ENST00000390344ENST00000390345ENST00000390346ENST00000419915ENST00000422161ENST00000426039ENST00000426402ENST00000427089ENST00000436911ENST00000443402ENST00000444775
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT cytosol;  nuclear;  plasma membrane;  Other; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsC011610;  AGhsC080514; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 NA
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3046530; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  605635
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name NA
Disease NA
Substance NA
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
146 .. 146 C/A rs60737043 - CDS Synonymous[Ile48Ile]
206 .. 206 A/G rs1053756 + CDS Synonymous[Ser68Ser]
221 .. 221 A/G rs1053757 + CDS Synonymous[Lys73Lys]
221 .. 221 A/G rs71546638 - CDS Synonymous[Lys73Lys]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer