H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000324733 Accession number: X93783 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Ig kappa chain V-II region GM607; Precursor; Fragment;
 
 

Motif information
ORF

length(120),orf(1:360)
DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGNNYLDWYLQKPGQSPQ
LLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
FTFGPGTKVDIKRTVAAPSV
a.a.
length
InterPro Name
length(93), motif(1:93) 93 IPR007110 Immunoglobulin-like domain [Domain]
length(108), motif(2:109) 108 IPR013783 Immunoglobulin-like fold [Domain]
length(108), motif(2:109) 108 IPR013106 Immunoglobulin V-set domain [Domain]