H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000324733 Accession number: X93783 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Ig kappa chain V-II region GM607; Precursor; Fragment;
 
 

Transcript original information
Accession number X93783.1
CAGE tag ID NA
EST ID NA
Clone Number TOP104
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 360[bp] (No. of exon:2)[A:81 T:90 G:92 C:97]
Devision HUM
Molecular type mRNA
Library origin Cell type B lymphocyte
Tissue type peripheral blood
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N/C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0161619
Genomic location  G-integra Help Chromosome 2
Location 2p11.2
Position 89160732- 89521478
Strand -
Possible duplicated location(s) NA
Gene structure 2 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000004631
Predicted CDS 1..360;  120[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.784

Motif information
ORF

length(120),orf(1:360)
DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGNNYLDWYLQKPGQSPQ
LLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTP
FTFGPGTKVDIKRTVAAPSV
a.a.
length
InterPro Name
length(93), motif(1:93) 93 IPR007110 Immunoglobulin-like domain [Domain]
length(108), motif(2:109) 108 IPR013783 Immunoglobulin-like fold [Domain]
length(108), motif(2:109) 108 IPR013106 Immunoglobulin V-set domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000324733
H-Inv cluster ID Locus viewHIX0161619
Accession number X93783.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Ig kappa chain V-II region GM607; Precursor; Fragment;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (P06309)  [Identity/coverage = 94.69%/96.58%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 6325927ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ NA
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000004631
No. of interaction 3
Interaction partner(s) HIP000058866HIP000066619HIP000071861
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function protein binding (GO:0005515); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol;  extracellular; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 214768_x_at; 
HG-U133A 214768_x_at; 
HG-U133A_2 214768_x_at; 
HG-U133B NA
HG-U133_Plus_2 214768_x_at; 
HG-U95 31586_f_at; 
HG-U95A 31586_f_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2493229;  2493232;  2493234;  2494830;  2563900;  2563961;  3951641; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
2 .. 2 A/G rs11546063 + CDS Nonsynonymous[Asp1Gly]
19 .. 19 T/C rs441602 + CDS Nonsynonymous[Ser7Pro]
84 .. 84 C/T rs11546062 + CDS Synonymous[Ser28Ser]
90 .. 90 G/C rs3747638 + CDS Synonymous[Leu30Leu]
90 .. 90 G/C rs200048221 - CDS Synonymous[Leu30Leu]
139 .. 139 C/A rs201820758 - CDS Nonsynonymous[Gln47Lys]
168 .. 168 T/C rs11546096 + CDS Synonymous[Gly56Gly]
173 .. 173 A/G rs11546095 + CDS Nonsynonymous[Asn58Ser]
176 .. 176 G/A rs200881242 - CDS Nonsynonymous[Arg59Gln]
178 .. 178 G/T rs199917475 - CDS Nonsynonymous[Ala60Ser]
198 .. 198 G/A rs11546093 + CDS Synonymous[Arg66Arg]
218 .. 218 G/A rs11546092 + CDS Nonsynonymous[Gly73Asp]
237 .. 237 A/G rs11546091 + CDS Synonymous[Lys79Lys]
242 .. 242 G/C rs11546094 + CDS Nonsynonymous[Ser81Thr]
301 .. 301 T/C rs139877244 - CDS Nonsynonymous[Phe101Leu]
307 .. 307 T/G rs72847528 - CDS Nonsynonymous[Phe103Val]
308 .. 308 T/G rs190475170 - CDS Nonsynonymous[Phe103Cys]
315 .. 315 T/C rs112915083 - CDS Synonymous[Pro105Pro]
321 .. 321 C/T rs186782281 - CDS Synonymous[Thr107Thr]
322 .. 322 A/G rs181878952 - CDS Nonsynonymous[Lys108Glu]
324 .. 324 A/G rs149374792 - CDS Synonymous[Lys108Lys]
328 .. 328 G/C rs188533155 - CDS Nonsynonymous[Asp110His]
331 .. 331 A/G rs72847527 - CDS Nonsynonymous[Ile111Val]
337 .. 337 C/T/A rs138460143 - CDS
338 .. 338 G/T rs78953831 - CDS Nonsynonymous[Arg113Leu]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer