H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000323271 Accession number: X72429 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to Ig kappa chain V-II region GM607; Precursor; Fragment;
 
 

Motif information
ORF

length(122),orf(4:371)
MLWVSGSSGDIVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYDYLDWY
LQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGIY
YCMQALQTPSVTSAKGHDWRLN
a.a.
length
InterPro Name
length(97), motif(1:97) 97 IPR013783 Immunoglobulin-like fold [Domain]
length(104), motif(9:112) 104 IPR007110 Immunoglobulin-like [Domain]
length(96), motif(11:106) 96 IPR013106 Immunoglobulin V-set [Domain]
length(99), motif(17:115) 99 IPR003599 Immunoglobulin subtype [Domain]
length(78), motif(27:104) 78 IPR003596 Immunoglobulin V-set, subgroup [Domain]