H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000300499 Accession number: CR621304 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to HLA class I histocompatibility antigen, A-3 alpha chain; MHC class I antigen A*3; Precursor;
 
 

Motif information
ORF

length(363),orf(2:1093)
VMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYV
DDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDL
GTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNE
DLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKET
LQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDT
ELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSS
QPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDS
AQGSDVSLTACKV*
a.a.
length
InterPro Name
length(192), motif(17:208) 192 IPR011161 MHC class I-like antigen recognition [Domain]
length(181), motif(23:203) 181 IPR011162 MHC classes I/II-like antigen recognition protein [Domain]
length(179), motif(23:201) 179 IPR001039 MHC class I, alpha chain, alpha1/alpha2 [Domain]
length(30), motif(81:110) 30 IPR001039 MHC class I, alpha chain, alpha1/alpha2 [Domain]
length(17), motif(113:129) 17 IPR001039 MHC class I, alpha chain, alpha1/alpha2 [Domain]
length(18), motif(134:151) 18 IPR001039 MHC class I, alpha chain, alpha1/alpha2 [Domain]
length(19), motif(179:197) 19 IPR001039 MHC class I, alpha chain, alpha1/alpha2 [Domain]
length(87), motif(207:293) 87 IPR007110 Immunoglobulin-like [Domain]
length(100), motif(209:308) 100 IPR013783 Immunoglobulin-like fold [Domain]
length(76), motif(217:292) 76 IPR003597 Immunoglobulin C1-set [Domain]
length(72), motif(220:291) 72 IPR003597 Immunoglobulin C1-set [Domain]
length(7), motif(279:285) 7 IPR003006 Immunoglobulin/major histocompatibility complex, conserved site [Conserved_site]
length(28), motif(335:362) 28 IPR010579 MHC class I, alpha chain, C-terminal [Domain]