H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000289559 Accession number: CR610364 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Thy-1 membrane glycoprotein preproprotein.
 
 

Transcript original information
Accession number CR610364.1
CAGE tag ID NA
EST ID NA
Clone Number CS0DE008YC01
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (THY1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (THY1);
Sequence data provider NA
Annotation project NA
Length of cDNA 1759[bp] (No. of exon:4)[A:380 T:354 G:482 C:543]
Devision HTC
Molecular type mRNA
Library origin Cell type NA
Tissue type Placenta
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0010195
Genomic location  G-integra Help Chromosome 11
Location 11q23.3
Position 119288955- 119293908
Strand -
Possible duplicated location(s) NA
Gene structure 4 exon(s)
Database links RefSeq NM_006288
Ensembl ENST00000284240ENST00000524659ENST00000524970ENST00000527590ENST00000528295ENST00000528522ENST00000532974ENST00000533840
Entrez Gene Entrez Gene ID:7070
KEGG GENES KEGG GENES(7070)
GeneCard GeneCardTHY1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000080514
Predicted CDS 111..596;  161[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.798
Database links RefSeq NP_006279
UniProt B0YJA4P04216
CCDS CCDS8424

Motif information
ORF

length(161),orf(111:596)
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQY
EFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEG
TYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSL
SLLQATDFMSL*
a.a.
length
InterPro Name
length(117), motif(5:121) 117 IPR007110 Immunoglobulin-like [Domain]
length(94), motif(30:123) 94 IPR013783 Immunoglobulin-like fold [Domain]
length(73), motif(32:104) 73 IPR013151 Immunoglobulin [Domain]
length(74), motif(33:106) 74 IPR003596 Immunoglobulin V-set, subgroup [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000289559
H-Inv cluster ID Locus viewHIX0010195
Accession number CR610364.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Thy-1 membrane glycoprotein preproprotein.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_006279)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol THY1
HGNC aliases NA
HGNC name Thy-1 cell surface antigen
DDBJ NA
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000080514
No. of interaction 6
Interaction partner(s) HIP000029955HIP000055075HIP000055239HIP000080514HIP000090938HIP000256298
BIND NA
DIP NA
MINT NA
HPRD 00411;  00655;  01080;  01428;  01769;  01903; 
IntAct NA
Database links RefSeq NM_006288
Ensembl ENST00000284240ENST00000524659ENST00000524970ENST00000527590ENST00000528295ENST00000528522ENST00000532974ENST00000533840
Entrez Gene Entrez Gene ID:7070
KEGG GENES KEGG GENES(7070)
GeneCard GeneCardTHY1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT extracellular; 
Target P signal peptide
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:26-Mar-2013
Start End PDB_ID E-value Identity Coverage SCOP_ID
32 122 1dr9A1 4e-05 16.5 91/105 b.1.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA020421;  AGhsC021111; 
Affymetrix
GeneChip
HG-Focus 208850_s_at; 
HG-U133 208850_s_at;  208851_s_at;  213869_x_at; 
HG-U133A 208850_s_at;  208851_s_at;  213869_x_at; 
HG-U133A_2 208850_s_at;  208851_s_at;  213869_x_at; 
HG-U133B NA
HG-U133_Plus_2 208850_s_at;  208851_s_at;  213869_x_at; 
HG-U95 39395_at; 
HG-U95A 39395_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3352207;  3352208;  3352209;  3394417;  3394418;  3394419;  3394420;  3394421;  3394422;  3394423;  3394424;  3394425;  3394430; 
HuGeneFL M11749_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P36364;  A_23_P47756; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P36364; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  604499607967609270609470611010
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(7070)
Disease Entrez Gene ID:(7070)
Substance Entrez Gene ID:(7070)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
215 .. 215 T/A rs11574654 + CDS Synonymous[Arg35Arg]
323 .. 323 G/A rs35922941 - CDS Synonymous[Glu71Glu]
333 .. 333 C/A rs11546392 + CDS Nonsynonymous[Arg75Ser]
413 .. 413 C/G rs11546394 + CDS Synonymous[Thr101Thr]
418 .. 418 C/T rs45441500 - CDS Nonsynonymous[Thr103Met]
461 .. 461 C/A rs11546391 + CDS Synonymous[Ser117Ser]
467 .. 467 C/T rs111763470 - CDS Synonymous[Asn119Asn]
680 .. 680 C/G rs1054735 + 3'UTR
730 .. 730 G/C rs111339732 - 3'UTR
795 .. 795 C/A rs112225059 - 3'UTR
871 .. 871 G/A rs12291644 - 3'UTR
944 .. 944 G/T rs13770 - 3'UTR
1070 .. 1070 C/G rs114912758 - 3'UTR
1361 .. 1361 G/A rs112627114 - 3'UTR
1462 .. 1462 C/T rs1055370 + 3'UTR
1528 .. 1528 C/T rs1064070 + 3'UTR
1601 .. 1601 C/T rs11546395 - 3'UTR
1639 .. 1639 C/T rs113417916 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer