H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000289019 Accession number: CR609824 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: 14-3-3 protein epsilon.
 
 

Motif information
ORF

length(255),orf(33:800)
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYK
NVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDI
LDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLV
AYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFD
DAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDV
EDENQ*
a.a.
length
InterPro Name
length(234), motif(1:234) 234 IPR000308 14-3-3 protein [Family]
length(247), motif(2:248) 247 IPR000308 14-3-3 protein [Family]
length(244), motif(2:245) 244 IPR000308 14-3-3 protein [Family]
length(231), motif(3:233) 231 IPR000308 14-3-3 protein [Family]
length(234), motif(4:237) 234 IPR000308 14-3-3 protein [Family]
length(242), motif(4:245) 242 IPR000308 14-3-3 protein [Family]
length(30), motif(36:65) 30 IPR000308 14-3-3 protein [Family]
length(11), motif(42:52) 11 IPR000308 14-3-3 protein [Family]
length(25), motif(85:109) 25 IPR000308 14-3-3 protein [Family]
length(23), motif(116:138) 23 IPR000308 14-3-3 protein [Family]
length(27), motif(151:177) 27 IPR000308 14-3-3 protein [Family]
length(27), motif(178:204) 27 IPR000308 14-3-3 protein [Family]
length(30), motif(205:234) 30 IPR000308 14-3-3 protein [Family]
length(20), motif(214:233) 20 IPR000308 14-3-3 protein [Family]