H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
Locus viewLocus view Protein view Protein view G-integraG-integra DiseaseInfo ViewerDiseaseInfo Viewer H-ANGELH-ANGEL EvolaEvola PPI viewerPPI view Gene Family/GroupGene Family/Group Hyperlink managemnet system (All databases)Hyperlink MS
H-Invitational ID: HIT000268707 Accession number: CR541836 Created date: 26-Mar-2013 Last modified: 20-Apr-2012
Definition: Tryptase alpha/beta-1; Tryptase-1; EC=3.4.21.59; Tryptase I; Tryptase alpha-1; Precursor;
 
 

Transcript original information
Accession number CR541836.1
CAGE tag ID NA
EST ID NA
Clone Number RZPDo834B0932D
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (TPSAB1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (TPSAB1);
Sequence data provider NA
Annotation project NA
Length of cDNA 825[bp] (No. of exon:5)[A:151 T:132 G:259 C:283]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0012676
Genomic location  G-integra Help Chromosome 16
Location 16p13.3
Position 1290940- 1292238
Strand +
Possible duplicated location(s) NA
Gene structure 5 exon(s)
Database links RefSeq NM_003294
Ensembl ENST00000338844ENST00000423126ENST00000430512ENST00000461509
Entrez Gene Entrez Gene ID:7177
KEGG GENES KEGG GENES(7177)
GeneCard GeneCardTPSAB1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000074371
Predicted CDS 1..825;  275[aa];  Orientation:+1; 
Codon Adaptation Index (CAI).
Database links RefSeq NA
UniProt Q6FHB8
CCDS NA

Motif information
ORF

length(275),orf(1:825)
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRV
HGPYWMHFCGGTLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQ
LLPVSRTIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFP
PGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGD
DVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQ
PNRPGIYTRVTYYLDWIHHYVPKKP
a.a.
length
InterPro Name
length(238), motif(30:267) 238 IPR001254 Peptidase S1/S6, chymotrypsin/Hap [Domain]
length(245), motif(31:275) 245 IPR009003 Peptidase cysteine/serine, trypsin-like [Domain]
length(237), motif(31:267) 237 IPR001254 Peptidase S1/S6, chymotrypsin/Hap [Domain]
length(242), motif(31:272) 242 IPR001254 Peptidase S1/S6, chymotrypsin/Hap [Domain]
length(16), motif(60:75) 16 IPR001314 Peptidase S1A, chymotrypsin-type [Family]
length(6), motif(70:75) 6 IPR018114 Peptidase S1/S6, chymotrypsin/Hap, active site [Active_site]
length(15), motif(117:131) 15 IPR001314 Peptidase S1A, chymotrypsin-type [Family]
length(13), motif(217:229) 13 IPR001314 Peptidase S1A, chymotrypsin-type [Family]
length(12), motif(218:229) 12 IPR018114 Peptidase S1/S6, chymotrypsin/Hap, active site [Active_site]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000268707
H-Inv cluster ID Locus viewHIX0012676
Accession number CR541836.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Tryptase alpha/beta-1; Tryptase-1; EC=3.4.21.59; Tryptase I; Tryptase alpha-1; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q15661)  [Identity/coverage = 99.273%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 21871932677049354300499208771089810812162961146709191548933415616553180395271915921819748655ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol TPSAB1
HGNC aliases "tryptase beta 1"
HGNC name tryptase alpha/beta 1
DDBJ TPSB2
UniProt TPSAB1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000074371
No. of interaction 46
Interaction partner(s) HIP000025714HIP000026195HIP000029340HIP000029497HIP000030905HIP000031927HIP000035736HIP000035736HIP000036861HIP000041686HIP000041686HIP000044161HIP000054354HIP000058385HIP000065350HIP000065563HIP000065702HIP000065702HIP000066454HIP000066501HIP000068366HIP000071861HIP000071861HIP000076079HIP000077194HIP000083491HIP000084360HIP000086068HIP000088104HIP000089312HIP000089312HIP000091500HIP000094939HIP000098105HIP000099885HIP000103618HIP000103900HIP000105729HIP000105729HIP000107647HIP000112222HIP000113911HIP000113911HIP000142143HIP000170047HIP000210236
BIND 130761; 
DIP 112421E;  113736E;  114192E;  114290E;  115553E;  115964E;  116928E;  117365E;  117481E;  177429E;  84416E; 
MINT MINT-17240;  MINT-17241;  MINT-17242;  MINT-62622;  MINT-62720;  MINT-62796;  MINT-6489355;  MINT-8201907; 
HPRD 00728;  01548;  01605;  01610;  02256;  02394;  03028;  03409;  04267;  04300;  04534;  04632;  04700;  09145;  10091;  10536;  11840;  12341;  12457;  13549;  15985;  16034; 
IntAct EBI-1075830;  EBI-1074429;  EBI-1060469;  EBI-1063090;  EBI-1071295;  EBI-1068302;  EBI-1063890;  EBI-1076295;  EBI-3248480;  EBI-3044058;  EBI-1080538;  EBI-1077961;  EBI-2626054;  EBI-1237540;  EBI-2372444;  EBI-394875;  EBI-348838;  EBI-443675;  EBI-443659;  EBI-443665; 
Database links RefSeq NM_003294
Ensembl ENST00000338844ENST00000423126ENST00000430512ENST00000461509
Entrez Gene Entrez Gene ID:7177
KEGG GENES KEGG GENES(7177)
GeneCard GeneCardTPSAB1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function catalytic activity (GO:0003824);  serine-type endopeptidase activity (GO:0004252); 
Biological process proteolysis (GO:0006508); 

Subcellular localization information  Last modified:20-Apr-2012
WoLF PSORT extracellular;  lysosome; 
Target P signal peptide
SOSUI soluble protein
TMHMM soluble protein
PTS1
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:20-Apr-2012
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  156850605013605021606668607339608558608903610260
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(7177)
Disease Entrez Gene ID:(7177)
Substance Entrez Gene ID:(7177)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
44 .. 44 G/C rs61729112 + CDS Nonsynonymous[Arg15Pro]
53 .. 53 C/T rs61739899 + CDS Nonsynonymous[Ala18Val]
68 .. 68 G/T rs1141965 + CDS Nonsynonymous[Gly23Val]
76 .. 76 C/G rs1960188 - CDS Nonsynonymous[Leu26Val]
83 .. 83 G/A rs1064770 + CDS Nonsynonymous[Arg28Gln]
86 .. 86 T/C rs112944038 + CDS Nonsynonymous[Val29Ala]
86 .. 86 T/C rs1064771 + CDS Nonsynonymous[Val29Ala]
90 .. 90 C/T rs112531166 + CDS Synonymous[Gly30Gly]
93 .. 93 C/T rs1800987 + CDS Synonymous[Ile31Ile]
96 .. 96 C/T rs17434400 + CDS Synonymous[Val32Val]
96 .. 96 C/T rs62012906 + CDS Synonymous[Val32Val]
129 .. 129 C/G rs1960187 - CDS Synonymous[Pro43Pro]
152 .. 152 A/G rs61753435 + CDS Nonsynonymous[His51Arg]
152 .. 152 A/G rs1060281 - CDS Nonsynonymous[His51Arg]
153 .. 153 C/T rs1800989 + CDS Synonymous[His51His]
155 .. 155 G/A rs17841227 + CDS Nonsynonymous[Gly52Asp]
158 .. 158 C/G rs17841226 + CDS Nonsynonymous[Pro53Arg]
171 .. 171 C/T rs1960186 - CDS Synonymous[His57His]
171 .. 171 C/T rs55701457 - CDS Synonymous[His57His]
174 .. 174 C/T rs2982423 - CDS Synonymous[Phe58Phe]
177 .. 177 C/T rs2230084 + CDS Synonymous[Cys59Cys]
309 .. 309 G/A rs1064773 + CDS Synonymous[Pro103Pro]
333 .. 333 A/C rs2234903 + CDS Synonymous[Pro111Pro]
344 .. 344 C/T rs1064774 + CDS Nonsynonymous[Thr115Ile]
346 .. 346 G/A rs1064775 + CDS Nonsynonymous[Ala116Thr]
347 .. 347 C/T rs1064776 + CDS Nonsynonymous[Ala116Val]
353 .. 354 TC/CT rs71376589 - CDS
363 .. 363 C/T rs1064777 + CDS Synonymous[Asp121Asp]
390 .. 390 G/C rs1064778 + CDS Synonymous[Pro130Pro]
396 .. 396 C/G rs1800991 + CDS Nonsynonymous[Asn132Lys]
397 .. 397 G/A rs1064779 + CDS Nonsynonymous[Val133Ile]
407 .. 407 A/G rs1064780 + CDS Nonsynonymous[His136Arg]
421 .. 421 A/G rs1800992 + CDS Nonsynonymous[Thr141Ala]
422 .. 422 C/T rs1064781 + CDS Nonsynonymous[Thr141Ile]
423 .. 423 C/G rs1064782 + CDS Synonymous[Thr141Thr]
438 .. 438 A/G rs1064783 + CDS Synonymous[Ser146Ser]
451 ^ 452 -/C rs2234647 + CDS
484 .. 484 G/A rs2234641 + CDS Nonsynonymous[Asp162Asn]
503 .. 503 G/C rs1141969 + CDS Nonsynonymous[Arg168Pro]
508 .. 508 C/T rs2234904 + CDS Nonsynonymous[Pro170Ser]
522 .. 522 T/C rs1141970 + CDS Synonymous[Pro174Pro]
613 .. 613 G/A rs1060284 + CDS Nonsynonymous[Val205Ile]
644 .. 644 C/G rs2234905 + CDS Nonsynonymous[Thr215Ser]
647 .. 647 G/A rs2234906 + CDS Nonsynonymous[Arg216Gln]
657 .. 657 A/C rs2234907 + CDS Synonymous[Ser219Ser]
661 .. 661 C/A rs17841224 + CDS Nonsynonymous[Gln221Lys]
672 .. 672 C/T rs1137383 + CDS Synonymous[Ser224Ser]
711 .. 711 G/A rs1060290 + CDS Synonymous[Leu237Leu]
734 .. 734 G/A rs1060292 + CDS Nonsynonymous[Gly245Asp]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer