H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000268586 Accession number: CR541713 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Interferon regulatory factor 1.
 
 

Transcript original information
Accession number CR541713.1
CAGE tag ID NA
EST ID NA
Clone Number RZPDo834B0329D
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (IRF1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (IRF1);
Sequence data provider NA
Annotation project NA
Length of cDNA 975[bp] (No. of exon:9)[A:259 T:182 G:269 C:265]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0005159
Genomic location  G-integra Help Chromosome 5
Location 5q31.1
Position 131819646- 131825170
Strand -
Possible duplicated location(s) NA
Gene structure 9 exon(s)
Database links RefSeq NM_002198
Ensembl ENST00000245414ENST00000405885ENST00000437654ENST00000439555ENST00000458069ENST00000459982ENST00000463784ENST00000472045ENST00000476613ENST00000493208
Entrez Gene Entrez Gene ID:3659
KEGG GENES KEGG GENES(3659)
GeneCard GeneCardIRF1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000084307
Predicted CDS 1..975;  325[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.822
Database links RefSeq NP_002189
UniProt P10914Q6FHN8
CCDS CCDS4155

Motif information
ORF

length(325),orf(1:975)
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINK
DACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRN
KGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSD
GLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVE
VVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTN
VDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
MDATWLDSLLTPVRLPSIQAIPCAP
a.a.
length
InterPro Name
length(315), motif(1:315) 315 IPR017431 Interferon regulatory factor-1/2 [Family]
length(114), motif(1:114) 114 IPR001346 Interferon regulatory factor [Domain]
length(112), motif(2:113) 112 IPR011991 Winged helix-turn-helix transcription repressor DNA-binding [Domain]
length(109), motif(5:113) 109 IPR001346 Interferon regulatory factor [Domain]
length(20), motif(7:26) 20 IPR001346 Interferon regulatory factor [Domain]
length(34), motif(26:59) 34 IPR019817 Interferon regulatory factor, conserved site [Conserved_site]
length(14), motif(33:46) 14 IPR001346 Interferon regulatory factor [Domain]
length(18), motif(51:68) 18 IPR001346 Interferon regulatory factor [Domain]
length(23), motif(74:96) 23 IPR001346 Interferon regulatory factor [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000268586
H-Inv cluster ID Locus viewHIX0005159
Accession number CR541713.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Interferon regulatory factor 1.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_002189)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol IRF1
HGNC aliases NA
HGNC name interferon regulatory factor 1
DDBJ IRF1
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000084307
No. of interaction 12
Interaction partner(s) HIP000022609HIP000025414HIP000026075HIP000037612HIP000039881HIP000051820HIP000088757HIP000096721HIP000096938HIP000097433HIP000100966HIP000101884
BIND NA
DIP 115228E;  88067E;  88068E; 
MINT NA
HPRD 01238;  01241;  02777;  02829;  02867;  03336;  03554;  04078;  06780;  07223;  10556; 
IntAct EBI-3931236;  EBI-1067616;  EBI-3906874; 
Database links RefSeq NM_002198
Ensembl ENST00000245414ENST00000405885ENST00000437654ENST00000439555ENST00000458069ENST00000459982ENST00000463784ENST00000472045ENST00000476613ENST00000493208
Entrez Gene Entrez Gene ID:3659
KEGG GENES KEGG GENES(3659)
GeneCard GeneCardIRF1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function transcription factor activity (GO:0003700); 
Biological process regulation of transcription, DNA-dependent (GO:0006355); 
Cellular component nucleus (GO:0005634); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT nuclear; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:26-Mar-2013
Start End PDB_ID E-value Identity Coverage SCOP_ID
7 111 1if1A 9e-47 100.0 105/105 a.4.5.23
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA220418; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 NA
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2875351;  2875353;  2875356;  2875358;  2875360;  2875362;  2875363;  2875364;  2875365;  2875366;  2875372; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name: Gastric cancer (137215);  Disease name: Macrocytic anemia, refractory, of 5q- syndrome (153550); 
Related information in OMIM OMIM ID:  147575;  Title: INTERFERON REGULATORY FACTOR 1
Co-localized orphan diseases OMIM ID:  601888608850611091612554612571
Disease related mutation MutationView:  147575
JRE-1.4.0 or later is required.Download JRE at Sun's web site.
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(3659)
Disease Entrez Gene ID:(3659)
Substance Entrez Gene ID:(3659)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
102 .. 102 C/T rs117282832 - CDS Synonymous[Phe34Phe]
345 .. 345 C/G rs17622685 - CDS Synonymous[Leu115Leu]
555 .. 555 G/A rs9282762 + CDS Synonymous[Pro185Pro]
579 .. 579 C/T rs17848410 + CDS Synonymous[Pro193Pro]
852 .. 852 G/C rs113976540 - CDS Synonymous[Gly284Gly]
943 .. 943 T/C rs55746618 - CDS Synonymous[Leu315Leu]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer