H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
Locus viewLocus view Protein view Protein view G-integraG-integra DiseaseInfo ViewerDiseaseInfo Viewer H-ANGELH-ANGEL EvolaEvola PPI viewerPPI view Gene Family/GroupGene Family/Group Hyperlink managemnet system (All databases)Hyperlink MS
H-Invitational ID: HIT000267132_03 Accession number: CR407635 Created date: 26-Mar-2013 Last modified: 20-Apr-2012
Definition: Low affinity immunoglobulin gamma Fc region receptor II-b isoform 3 precursor.
 
 

Transcript original information
Accession number CR407635.1
CAGE tag ID NA
EST ID NA
Clone Number RZPDo834F022D
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (FCGR2B) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (FCGR2B);
Sequence data provider NA
Annotation project NA
Length of cDNA 873[bp] (No. of exon:7)[A:204 T:194 G:218 C:257]
Devision NA
Molecular type NA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGCAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001249
Genomic location  G-integra Help Chromosome 1
Location 1q23.3
Position 161633032- 161647340
Strand +
Possible duplicated location(s) NA
Gene structure 7 exon(s)
Database links RefSeq NM_004001;  NM_001002273;  NM_001002274;  NM_001002275;  NM_001190828; 
Ensembl ENST00000236937;  ENST00000358671;  ENST00000367960;  ENST00000367961;  ENST00000367962;  ENST00000403078;  ENST00000428605;  ENST00000452001;  ENST00000480308;  ENST00000485778; 
Entrez Gene Entrez Gene ID:2213; 
KEGG GENES KEGG GENES(2213); 
GeneCard GeneCardFCGR2B;  *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra;  cDNA-genome alignmentcDNA-genome alignment; 

Predicted CDS information
HIP ID HIP000057064
Predicted CDS 1..873;  291[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.83
Database links RefSeq NP_001002274; 
UniProt NA
CCDS CCDS30925; 

Motif information
ORF

length(291),orf(1:873) MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKA VLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYR FKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVL RCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNI GYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKK RISANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI 		a.a.
length		 InterPro Name
length(82), motif(47:128) 82 IPR013783 Immunoglobulin-like fold [Domain]
length(80), motif(48:127) 80 IPR007110 Immunoglobulin-like [Domain]
length(74), motif(56:129) 74 IPR003599 Immunoglobulin subtype [Domain]
length(83), motif(131:213) 83 IPR007110 Immunoglobulin-like [Domain]
length(85), motif(133:217) 85 IPR013783 Immunoglobulin-like fold [Domain]
length(79), motif(137:215) 79 IPR003599 Immunoglobulin subtype [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000267132_03
H-Inv cluster ID Locus viewHIX0001249
Accession number CR407635.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Low affinity immunoglobulin gamma Fc region receptor II-b isoform 3 precursor.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_001002274)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID HIF0000234
Gene family/group name Immunoglobulin-like (IPR007110).
Evidence motif (InterPro) ID IPR007110
Gene symbol/name HGNC symbol FCGR2B
HGNC aliases "Fc fragment of IgG, low affinity IIb, receptor for (CD32)"
HGNC name Fc fragment of IgG, low affinity IIb, receptor (CD32)
DDBJ FCGR2B
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
 Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000057064
No. of interaction 18
Interaction partner(s) HIP000022009;  HIP000024649;  HIP000035818;  HIP000036574;  HIP000040764;  HIP000041413;  HIP000042124;  HIP000044618;  HIP000044897;  HIP000059017;  HIP000059017;  HIP000069004;  HIP000082878;  HIP000086431;  HIP000086431;  HIP000134584;  HIP000134584;  HIP000176149; 
BIND 185360;  258420;  258897; 
DIP NA
MINT MINT-4052274;  MINT-4052302;  MINT-4052327;  MINT-4052351;  MINT-7255483;  MINT-7255549;  MINT-7255586;  MINT-7255609;  MINT-7255636; 
HPRD 00510;  01140;  02209;  05407;  05431;  06782;  08493;  09052;  09175;  12275; 
IntAct EBI-3221844;  EBI-2695793; 
Database links RefSeq NM_004001;  NM_001002273;  NM_001002274;  NM_001002275;  NM_001190828; 
Ensembl ENST00000236937;  ENST00000358671;  ENST00000367960;  ENST00000367961;  ENST00000367962;  ENST00000403078;  ENST00000428605;  ENST00000452001;  ENST00000480308;  ENST00000485778; 
Entrez Gene Entrez Gene ID:2213; 
KEGG GENES KEGG GENES(2213); 
GeneCard GeneCardFCGR2B;  *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases; 
Curation status Auto-annotated
Notes NA
Related H-InvDB links Immunoglobulin-like (IPR007110). Similarity Search ToolSimilarity Search Tool;  TACTTACT; 
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:20-Apr-2012
WoLF PSORT extracellular;  endoplasmic;  plasma membrane;  Other; 
Target P signal peptide
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:20-Apr-2012
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  115665;  116600;  155600;  600975;  605225;  605606;  606788;  606852;  606928;  607317;  607671;  608543;  608553;  608995;  610320;  612367;  612596; 
Disease related mutation
JRE-1.4.0 or later is required.Download JRE at Sun's web site.
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(2213)
Disease Entrez Gene ID:(2213)
Substance Entrez Gene ID:(2213)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo Viewer;  LEGENDALEGENDA; 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
18 .. 18 C/T rs6681090 + CDS Synonymous[Phe6Phe]
128 .. 128 C/T rs59388251 + CDS Nonsynonymous[Thr43Ile]
169 .. 169 C/T rs10917661 + CDS AA-STOP[Gln57*]
189 .. 189 G/A rs5017568 + CDS Synonymous[Gln63Gln]
248 .. 248 A/C rs5017567 + CDS Nonsynonymous[Gln83Pro]
336 .. 336 G/A rs6665610 + CDS Synonymous[Thr112Thr]
458 .. 458 A/G rs61731480 + CDS Nonsynonymous[His153Arg]
507 .. 507 A/C rs112318761 + CDS Synonymous[Gly169Gly]
609 .. 609 G/A rs2298022 + CDS Synonymous[Thr203Thr]
614 .. 614 A/T rs1050499 + CDS Nonsynonymous[Tyr205Phe]
695 .. 695 T/C rs1050501 + CDS Nonsynonymous[Ile232Thr]
834 .. 834 C/T rs115842547 + CDS Synonymous[His278His]
845 .. 845 T/C rs61804185 + CDS Nonsynonymous[Leu282Pro]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD); 
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer;