H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000267132_03 Accession number: CR407635 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Low affinity immunoglobulin gamma Fc region receptor II-b; IgG Fc receptor II-b; CDw32; Fc-gamma RII-b; Fc-gamma-RIIb; FcRII-b; AltName: CD_antigen=CD32; Precursor;
 
 

Transcript original information
Accession number CR407635.1
CAGE tag ID NA
EST ID NA
Clone Number RZPDo834F022D
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (FCGR2B) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (FCGR2B);
Sequence data provider NA
Annotation project NA
Length of cDNA 873[bp] (No. of exon:7)[A:204 T:194 G:218 C:257]
Devision NA
Molecular type NA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGCAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001249
Genomic location  G-integra Help Chromosome 1
Location 1q23.3
Position 161633032- 161647340
Strand +
Possible duplicated location(s) NA
Gene structure 7 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2213
KEGG GENES KEGG GENES(2213)
GeneCard GeneCardFCGR2B*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000057064
Predicted CDS 1..873;  291[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.796
Database links RefSeq NP_001002274
UniProt NA
CCDS CCDS30925

Motif information
ORF

length(291),orf(1:873)
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKA
VLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYR
FKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVL
RCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNI
GYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKK
RISANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI
a.a.
length
InterPro Name
length(80), motif(48:127) 80 IPR007110 Immunoglobulin-like domain [Domain]
length(81), motif(49:129) 81 IPR013783 Immunoglobulin-like fold [Domain]
length(74), motif(56:129) 74 IPR003599 Immunoglobulin subtype [Domain]
length(83), motif(131:213) 83 IPR007110 Immunoglobulin-like domain [Domain]
length(85), motif(133:217) 85 IPR013783 Immunoglobulin-like fold [Domain]
length(79), motif(137:215) 79 IPR003599 Immunoglobulin subtype [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000267132_03
H-Inv cluster ID Locus viewHIX0001249
Accession number CR407635.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Low affinity immunoglobulin gamma Fc region receptor II-b; IgG Fc receptor II-b; CDw32; Fc-gamma RII-b; Fc-gamma-RIIb; FcRII-b; AltName: CD_antigen=CD32; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P31994)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 214246025293422531080832751284668618756631923244510064577121152301548933415914856167104141743516520385827ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol FCGR2B
HGNC aliases "Fc fragment of IgG, low affinity IIb, receptor for (CD32)"
HGNC name Fc fragment of IgG, low affinity IIb, receptor (CD32)
DDBJ FCGR2B
UniProt FCGR2B
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000057064
No. of interaction 18
Interaction partner(s) HIP000022009HIP000024649HIP000035818HIP000036574HIP000040764HIP000041413HIP000042124HIP000044618HIP000044897HIP000059017HIP000059017HIP000069004HIP000082878HIP000086431HIP000086431HIP000134584HIP000134584HIP000176149
BIND NA
DIP NA
MINT NA
HPRD 00101;  00422;  01301;  01475;  01496;  01866;  02900;  03227;  03479;  05201;  09033; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:2213
KEGG GENES KEGG GENES(2213)
GeneCard GeneCardFCGR2B*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function protein binding (GO:0005515); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT extracellular;  endoplasmic;  plasma membrane;  Other; 
Target P signal peptide
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
18 .. 18 C/T rs148087564 + CDS Synonymous[Phe6Phe]
18 .. 18 C/T rs6681090 + CDS Synonymous[Phe6Phe]
128 .. 128 C/T rs59388251 + CDS Nonsynonymous[Thr43Ile]
139 .. 139 C/T rs149249317 + CDS Nonsynonymous[Pro47Ser]
162 .. 162 C/G rs181249089 + CDS Synonymous[Leu54Leu]
169 .. 169 C/T rs10917661 + CDS AA-STOP[Gln57*]
180 .. 180 C/T rs138208658 + CDS Synonymous[Asn60Asn]
189 .. 189 G/A rs5017568 + CDS Synonymous[Gln63Gln]
219 .. 219 G/A rs144573139 + CDS Synonymous[Gly73Gly]
238 .. 238 G/A rs149985147 + CDS Nonsynonymous[Asp80Asn]
243 .. 243 C/T rs148030870 + CDS Synonymous[Ser81Ser]
248 .. 248 A/C rs5017567 + CDS Nonsynonymous[Gln83Pro]
268 .. 268 C/T rs141422960 + CDS Nonsynonymous[Leu90Phe]
285 .. 285 G/T rs201949883 + CDS Synonymous[Thr95Thr]
336 .. 336 G/A rs6665610 + CDS Synonymous[Thr112Thr]
364 .. 364 G/A rs143061521 + CDS Nonsynonymous[Asp122Asn]
369 .. 369 T/C rs140047756 + CDS Synonymous[Pro123Pro]
401 .. 401 T/G rs200112434 + CDS Nonsynonymous[Val134Gly]
458 .. 458 A/G rs61731480 + CDS Nonsynonymous[His153Arg]
507 .. 507 A/C rs112318761 + CDS Synonymous[Gly169Gly]
608 .. 608 C/T rs137950262 + CDS Nonsynonymous[Thr203Met]
609 .. 609 G/A rs146214041 + CDS Synonymous[Thr203Thr]
609 .. 609 G/A rs2298022 + CDS Synonymous[Thr203Thr]
612 .. 612 G/A rs182968886 + CDS Synonymous[Leu204Leu]
614 .. 614 A/T rs149301029 + CDS Nonsynonymous[Tyr205Phe]
614 .. 614 A/T rs1050499 + CDS Nonsynonymous[Tyr205Phe]
695 .. 695 T/C rs1050501 + CDS Nonsynonymous[Ile232Thr]
791 .. 791 A/G rs193030032 + CDS Nonsynonymous[Lys264Arg]
803 .. 803 A/C rs146056650 + CDS Nonsynonymous[Glu268Ala]
834 .. 834 C/T rs115842547 + CDS Synonymous[His278His]
845 .. 845 T/C rs61804185 + CDS Nonsynonymous[Leu282Pro]
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer