H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000265621 Accession number: BC075806 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Histone H4;
 
 

Motif information
ORF

length(103),orf(13:324)
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL
IYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
FGG*
a.a.
length
InterPro Name
length(102), motif(2:103) 102 IPR009072 Histone-fold [Domain]
length(100), motif(3:102) 100 IPR009072 Histone-fold [Domain]
length(12), motif(5:16) 12 IPR001951 Histone H4 [Family]
length(5), motif(15:19) 5 IPR019809 Histone H4, conserved site [Conserved_site]
length(75), motif(16:90) 75 IPR001951 Histone H4 [Family]
length(20), motif(20:39) 20 IPR001951 Histone H4 [Family]
length(67), motif(28:94) 67 IPR007125 Histone core [Domain]
length(21), motif(40:60) 21 IPR001951 Histone H4 [Family]
length(15), motif(62:76) 15 IPR001951 Histone H4 [Family]
length(13), motif(77:89) 13 IPR001951 Histone H4 [Family]
length(12), motif(89:100) 12 IPR001951 Histone H4 [Family]