H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
Locus viewLocus view Protein view Protein view G-integraG-integra DiseaseInfo ViewerDiseaseInfo Viewer H-ANGELH-ANGEL EvolaEvola PPI viewerPPI view Gene Family/GroupGene Family/Group Hyperlink managemnet system (All databases)Hyperlink MS
H-Invitational ID: HIT000265621 Accession number: BC075806 Created date: 26-Mar-2013 Last modified: 20-Apr-2012
Definition: Histone H4.
 
 

Transcript original information
Accession number BC075806.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:5225467
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (HIST1H4I) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (HIST1H4I);
Sequence data provider NA
Annotation project NA
Length of cDNA 1418[bp] (No. of exon:1)[A:422 T:379 G:314 C:303]
Devision HTC
Molecular type mRNA
Library origin Cell type NA
Tissue type Pancreas, Spleen, adult pooled
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1344(+) Signal: 1319-1323(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0005658
Genomic location  G-integra Help Chromosome 6
Location 6p22.1
Position 27107076- 27108419
Strand +
Possible duplicated location(s) NA
Gene structure 1 exon(s)
Database links RefSeq NM_003495; 
Ensembl ENST00000354348; 
Entrez Gene Entrez Gene ID:8294; 
KEGG GENES KEGG GENES(8294); 
GeneCard GeneCardHIST1H4I;  *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra;  cDNA-genome alignmentcDNA-genome alignment; 

Predicted CDS information
HIP ID HIP000098402
Predicted CDS 13..324;  103[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.841
Database links RefSeq NP_001029249;  NP_003486;  NP_003529;  NP_003530;  NP_003531;  NP_003532;  NP_003533;  NP_003534;  NP_003535;  NP_003536;  NP_003537;  NP_003539;  NP_068803;  NP_778224; 
UniProt A2CI30;  A3KPR4;  A7VME9;  B2R4R0;  B2RTM0;  B3FEB2;  B3FEB7;  B5DDY3;  B5FXC8;  C1C500;  C3XQS8;  C4QBN1;  D2HZU2;  D2N2J2;  D5J6Z3;  D9IA14;  E7D161;  F2Z4N2;  P62794;  P62795;  P62796;  P62797;  P62798;  P62799;  P62800;  P62801;  P62802;  P62803;  P62804;  P62805;  P62806;  Q28DR4;  Q45RT4;  Q4PM69;  Q4R362;  Q4SKJ2;  Q5DET3;  Q5RCS7;  Q6WV72;  Q6WV73;  Q6WV90;  Q7K8C0;  Q7KQD1; 
CCDS CCDS30847;  CCDS30851;  CCDS4571;  CCDS4572;  CCDS4583;  CCDS4589;  CCDS4593;  CCDS4598;  CCDS4604;  CCDS4620;  CCDS4630;  CCDS4631;  CCDS4637;  CCDS8665; 

Motif information
ORF

length(103),orf(13:324) MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL IYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG FGG* 		a.a.
length		 InterPro Name
length(102), motif(1:102) 102 IPR001951 Histone H4 [Family]
length(102), motif(2:103) 102 IPR009072 Histone-fold [Domain]
length(100), motif(3:102) 100 IPR009072 Histone-fold [Domain]
length(12), motif(5:16) 12 IPR001951 Histone H4 [Family]
length(5), motif(15:19) 5 IPR019809 Histone H4, conserved site [Conserved_site]
length(75), motif(16:90) 75 IPR001951 Histone H4 [Family]
length(20), motif(20:39) 20 IPR001951 Histone H4 [Family]
length(67), motif(28:94) 67 IPR007125 Histone core [Domain]
length(66), motif(28:93) 66 IPR004823 TATA box binding protein associated factor (TAF) [Domain]
length(21), motif(40:60) 21 IPR001951 Histone H4 [Family]
length(15), motif(62:76) 15 IPR001951 Histone H4 [Family]
length(13), motif(77:89) 13 IPR001951 Histone H4 [Family]
length(12), motif(89:100) 12 IPR001951 Histone H4 [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000265621
H-Inv cluster ID Locus viewHIX0005658
Accession number BC075806.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition Histone H4.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_778224)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID HIF0000790
Gene family/group name Histone H4 (IPR001951).
Evidence motif (InterPro) ID IPR001951
Gene symbol/name HGNC symbol HIST1H4I
HGNC aliases "H4 histone family, member M", "histone 1, H4i"
HGNC name histone cluster 1, H4i
DDBJ NA
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
 Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000098402
No. of interaction 129
Interaction partner(s) HIP000000470;  HIP000005979;  HIP000021401;  HIP000021427;  HIP000022242;  HIP000023266;  HIP000023694;  HIP000023789;  HIP000024053;  HIP000026502;  HIP000026502;  HIP000027917;  HIP000028305;  HIP000029551;  HIP000029910;  HIP000029985;  HIP000030139;  HIP000030994;  HIP000031656;  HIP000033190;  HIP000033190;  HIP000034291;  HIP000034507;  HIP000034622;  HIP000035861;  HIP000036396;  HIP000036396;  HIP000036549;  HIP000039590;  HIP000040678;  HIP000040680;  HIP000041828;  HIP000044307;  HIP000044667;  HIP000046743;  HIP000049801;  HIP000049801;  HIP000053167;  HIP000054593;  HIP000054593;  HIP000054826;  HIP000055870;  HIP000057536;  HIP000058916;  HIP000059185;  HIP000059982;  HIP000059982;  HIP000060692;  HIP000061444;  HIP000064438;  HIP000064456;  HIP000065414;  HIP000065414;  HIP000066578;  HIP000066604;  HIP000066936;  HIP000068180;  HIP000068180;  HIP000068736;  HIP000070217;  HIP000070356;  HIP000072983;  HIP000073894;  HIP000073894;  HIP000076124;  HIP000076357;  HIP000077597;  HIP000077597;  HIP000078197;  HIP000078197;  HIP000079679;  HIP000079679;  HIP000080656;  HIP000081421;  HIP000083074;  HIP000083279;  HIP000083623;  HIP000085006;  HIP000088104;  HIP000089945;  HIP000089945;  HIP000091250;  HIP000091666;  HIP000091666;  HIP000092689;  HIP000092689;  HIP000095247;  HIP000096037;  HIP000096070;  HIP000097214;  HIP000098079;  HIP000098409;  HIP000099408;  HIP000100997;  HIP000101847;  HIP000102204;  HIP000102317;  HIP000103109;  HIP000103653;  HIP000103706;  HIP000104193;  HIP000104340;  HIP000104785;  HIP000106438;  HIP000107442;  HIP000107442;  HIP000107493;  HIP000110770;  HIP000114950;  HIP000115324;  HIP000115602;  HIP000116212;  HIP000116775;  HIP000125020;  HIP000125493;  HIP000130328;  HIP000136193;  HIP000137998;  HIP000139098;  HIP000150678;  HIP000183185;  HIP000183185;  HIP000194034;  HIP000205251;  HIP000253284;  HIP000258392;  HIP000338892;  HIP000345899;  HIP000346335; 
BIND 153992;  177961;  182216;  183262;  183265;  183266;  200016;  295234;  297476;  318897;  318900;  318903;  318904;  318905;  318908;  318910;  335969;  335973;  89741;  89745; 
DIP 133139E;  135184E;  135188E;  135189E;  135190E;  137167E;  149E;  150E;  177021E;  177022E;  177023E;  177024E;  177025E;  177026E;  177027E;  177028E;  177029E;  177030E;  180094E;  180095E;  181755E;  45888E;  46794E;  59049E;  87759E;  87760E; 
MINT MINT-19344;  MINT-2490745;  MINT-2829358;  MINT-2829504;  MINT-2829542;  MINT-2829576;  MINT-2829624;  MINT-2829876;  MINT-2829895;  MINT-2829913;  MINT-2830323;  MINT-2830357;  MINT-2830381;  MINT-2830405;  MINT-2830429;  MINT-2981755;  MINT-2981779;  MINT-3296655;  MINT-48337;  MINT-48494;  MINT-49244;  MINT-49356;  MINT-4950280;  MINT-4950315;  MINT-56509;  MINT-6543302;  MINT-6543323;  MINT-6543349;  MINT-6665465;  MINT-7220359;  MINT-7899812;  MINT-7900157;  MINT-7914854;  MINT-7989539;  MINT-7989824;  MINT-7989846;  MINT-7989865;  MINT-7989882;  MINT-8010325; 
HPRD 00102;  00428;  00590;  00906;  00950;  00996;  00998;  01287;  01464;  01542;  01613;  01706;  01733;  02114;  02135;  02251;  02336;  02476;  02665;  02890;  02931;  03254;  03290;  03491;  03494;  03518;  03997;  04152;  04153;  04155;  04389;  04392;  04440;  04621;  04666;  04713;  04746;  04768;  05219;  05227;  05373;  05400;  05448;  05866;  06014;  06015;  06735;  06736;  06928;  07535;  07536;  08366;  08447;  08851;  08864;  09096;  09102;  09103;  09104;  09105;  09107;  09798;  09949;  09951;  10293;  10536;  11425;  11516;  11822;  11897;  11899;  11901;  11906;  11907;  11909;  11912;  12397;  12601;  13588;  13626;  13657;  13660;  15326;  15979;  15991;  16184;  16309;  16759;  17158;  17493; 
IntAct EBI-2880211;  EBI-2941238;  EBI-4288874;  EBI-1785756;  EBI-2418377;  EBI-1785741;  EBI-297600;  EBI-269146;  EBI-1265536;  EBI-1264642;  EBI-1785771;  EBI-2349206;  EBI-1264624;  EBI-1785708;  EBI-1264601;  EBI-1251862;  EBI-1264651;  EBI-1265385;  EBI-1264710;  EBI-1265363;  EBI-1265150;  EBI-1264717;  EBI-1270446;  EBI-1382486;  EBI-1268966;  EBI-2349158;  EBI-1265624;  EBI-1642362;  EBI-1270468;  EBI-1270487;  EBI-2349080;  EBI-2001855;  EBI-1642094;  EBI-1389994;  EBI-1389981;  EBI-2349066;  EBI-299155;  EBI-2477251;  EBI-2477216;  EBI-302174;  EBI-2477193;  EBI-2658272;  EBI-2426765;  EBI-2658174;  EBI-364198;  EBI-2477085;  EBI-2477238;  EBI-2477228;  EBI-2477221;  EBI-2657519;  EBI-3043770;  EBI-2477264;  EBI-362394;  EBI-3043800;  EBI-2651586;  EBI-2549359;  EBI-2477278;  EBI-2651040;  EBI-2564373;  EBI-361974;  EBI-3048562;  EBI-3046676;  EBI-360207;  EBI-3050465;  EBI-350217;  EBI-3946100;  EBI-3951754;  EBI-3892655;  EBI-4288861;  EBI-364504;  EBI-3951861;  EBI-4288898;  EBI-4288896;  EBI-4288900;  EBI-4288943;  EBI-4288945;  EBI-4288996;  EBI-4288947;  EBI-4289175;  EBI-4289129;  EBI-4289111;  EBI-4289000;  EBI-4288998;  EBI-4289145;  EBI-4291492;  EBI-4289455;  EBI-4289511;  EBI-4289462;  EBI-4289485;  EBI-4289466;  EBI-4407543;  EBI-4407371;  EBI-923469;  EBI-4488912;  EBI-4407598;  EBI-923503;  EBI-996840;  EBI-923564;  EBI-923575; 
Database links RefSeq NM_003495; 
Ensembl ENST00000354348; 
Entrez Gene Entrez Gene ID:8294; 
KEGG GENES KEGG GENES(8294); 
GeneCard GeneCardHIST1H4I;  *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases; 
Curation status Human curated
Notes NA
Related H-InvDB links Histone H4 (IPR001951). Similarity Search ToolSimilarity Search Tool;  TACTTACT; 
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function DNA binding (GO:0003677);  transcription initiation factor activity (GO:0016986); 
Biological process transcription initiation (GO:0006352);  nucleosome assembly (GO:0006334); 
Cellular component nucleus (GO:0005634);  nucleosome (GO:0000786); 

Subcellular localization information  Last modified:20-Apr-2012
WoLF PSORT nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:20-Apr-2012
Start End PDB_ID E-value Identity Coverage SCOP_ID
24 103 1aoiB 2e-14 100.0 80/83 a.22.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:20-Apr-2012
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator		 AceGene AGhsB011101; 
Affymetrix
GeneChip		 HG-Focus 214634_at; 
HG-U133 214634_at; 
HG-U133A 214634_at; 
HG-U133A_2 214634_at; 
HG-U133B NA
HG-U133_Plus_2 214634_at; 
HG-U95 762_f_at; 
HG-U95A 762_f_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2899770;  2899771;  2946719; 
HuGeneFL AB000905_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P361347;  A_23_P70458; 
Whole Human Genome Oligo Microarray:PGID247 A_24_P20873; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator; 

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:20-Apr-2012
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  122550;  143400;  604519;  608545;  610294;  611724;  612558; 
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(8294)
Disease Entrez Gene ID:(8294)
Substance Entrez Gene ID:(8294)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo Viewer;  LEGENDALEGENDA; 

Evolutionary information  Evola Help Last modified:20-Apr-2012
Relationship Species Accession number MGI Links
Orthology Rattus sp. (Rat) BC100619 G-integraG-integra
Orthology Mus sp. (Mouse) BC152397 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) CR719166 G-integraG-integra
Orthology Bos sp. (Cow) ENSBTAT00000044998 G-integraG-integra
Orthology Equus sp. (Horse) ENSECAT00000002444 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000018996 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001092924 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_001134995 G-integraG-integra
Orthology Canis sp. (Dog) XM_849000 G-integraG-integra
Phylogenetic tree [View by ATV]
 Neighbor-joining (phb) 
Related H-InvDB links EvolaEvola;  dN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
248 .. 248 G/A rs116193614 + CDS Nonsynonymous[Arg79His]
318 .. 318 C/T rs61742445 + CDS Synonymous[Gly102Gly]
327 .. 327 G/A rs112207956 + 3'UTR
445 .. 445 C/T rs116675691 + 3'UTR
532 .. 532 G/A rs76213641 + 3'UTR
535 .. 535 G/A rs79400360 + 3'UTR
724 .. 724 G/A rs75206923 + 3'UTR
790 .. 790 G/A rs6456769 + 3'UTR
923 .. 923 A/G rs73739600 + 3'UTR
1122 .. 1122 C/G rs16894241 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD); 
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer;