H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000249675 Accession number: AK131387 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Flap endonuclease GEN homolog 1; EC=3.1.-.-;
 
 

Motif information
ORF

length(908),orf(74:2800)
MGVNDLWQILEPVKQHIPLRNLGGKTIAVDLSLWVCEAQTVKKMMGSVMK
PHLRNLFFRISYLTQMDVKLVFVMEGEPPKLKADVISKRNQTRYGSSGKS
WSQKTGRSHFKSVLRECLHMLECLGIPWVQAAGEAEAMCAYLNAGGHVDG
CLTNDGDTFLYGAQTVYRNFTMNTKDPHVDCYTMSSIKSKLGLDRDALVG
LAILLGCDYLPKGVPGVGKEQALKLIQILKGQSLLQRFNRWNETSCNSSP
QLLVTKKLAHCSVCSHPGSPKDHERNGCRLCKSDKYCEPHDYEYCCPCEW
HRTEHDRQLNEVENNIKKKACCCEGFPFHEVIQEFLLNKDKLVKVIRYQR
PDLLLFQRFTLEKMEWPNHYACEKLLVLLTHYDMIERKLGSRNSNQLQPI
RIVKTRIRNGVHCFEIEWEKPEHYAMEDKQHGEFALLTIEEESLFEAAYP
EIVAVYQKQKLEIKGKKQKRIKPKENNLPEPDEVMSFQSHMTLKPTCEIF
HKQNSKLNSGISPDPTLPQESISASLNSLLLPKNTPCLNAQEQFMSSLRP
LAIQQIKAVSKSLISESSQPNTSSHNISVIADLHLSTIDWEGTSFSNSPA
IQRNTFSHDLKSEVESELSAIPDGFENIPEQLSCESERYTANIKKVLDED
SDGISPEEHLLSGITDLCLQDLPLKERIFIKLSYPQDNLQPDVNLKTLSI
LSVKESCIANSGSDCTSHLSKDLPGIPLQNESRDSKILKGDQLLQEDYKV
NTSVPYSVSNTVVKTCNVRPPNTALDHSRKVDMQTTRKILMKKSVCLDRH
SSDEQSAPVFGKAKYTTQRMKHSSQKHNSSHFKESGHNKLSSPKIHIKET
EQCVRSYETAENEESCFPDSTKSSLSSLQCHKKENNSGTCLDSPLPLCQR
LKLRFQST*
a.a.
length
InterPro Name
length(192), motif(1:192) 192 IPR029060 PIN domain-like [Domain]
length(93), motif(1:93) 93 IPR006085 XPG N-terminal [Domain]
length(96), motif(1:96) 96 IPR006085 XPG N-terminal [Domain]
length(207), motif(2:208) 207 IPR029060 PIN domain-like [Domain]
length(72), motif(122:193) 72 IPR006086 XPG-I domain [Domain]
length(86), motif(123:208) 86 IPR006086 XPG-I domain [Domain]
length(45), motif(193:237) 45 IPR020045 5'-3' exonuclease, C-terminal domain [Domain]
length(35), motif(195:229) 35 IPR008918 Helix-hairpin-helix motif, class 2 [Conserved_site]
length(63), motif(322:384) 63 IPR020045 5'-3' exonuclease, C-terminal domain [Domain]