H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000215687 Accession number: S51112 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Gonadotropin, beta subunit family protein.
 
 

Transcript original information
Accession number S51112.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider NA
Annotation project NA
Length of cDNA 262[bp] (No. of exon:0)[A:75 T:61 G:53 C:73]
Devision HUM
Molecular type mRNA
Library origin Cell type lymphocytes
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature N/C-truncated
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0052343
Genomic location  G-integra Help Chromosome UM
Location NA
Position NA
Strand NA
Possible duplicated location(s) NA
Gene structure  exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra;  cDNA-genome alignment; 

Predicted CDS information
HIP ID HIP000013633
Predicted CDS 2..262;  87[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.747
Database links RefSeq NA
UniProt Q15962
CCDS NA

Motif information
ORF

length(87),orf(2:262)
GYCMTRHINGKLFLPKYALSQDVCTYRDFIYRTVEIPGCPHHVAPYFSYP
VALSCKCGKCNTDYSDCTHEAVKTNYCTKPQKSYLVG
a.a.
length
InterPro Name
length(77), motif(1:77) 77 IPR006208 Cystine knot [Domain]
length(87), motif(1:87) 87 IPR001545 Gonadotropin, beta subunit [Family]
length(78), motif(1:78) 78 IPR001545 Gonadotropin, beta subunit [Family]
length(28), motif(50:77) 28 IPR018245 Gonadotropin, beta subunit, conserved site [Conserved_site]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000215687
H-Inv cluster ID Locus viewHIX0052343
Accession number S51112.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition Gonadotropin, beta subunit family protein.
Similarity category  Help Category: IPR domain containing protein(Category III).
InterPro domain (IPR001545) -containing protein.
Experimental evidence NA
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ thyrotropin beta subunit, TSH beta subu>
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000013633
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases; 
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function hormone activity (GO:0005179); 
Cellular component extracellular region (GO:0005576); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT extracellular;  mitochondria; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 NA
HG-U133A NA
HG-U133A_2 NA
HG-U133B NA
HG-U133_Plus_2 NA
HG-U95 NA
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 NA
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_24_P912490; 
Related H-InvDB links H-ANGELH-ANGEL;  DNAProbeLocatorDNAProbeLocator