H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000193787 Accession number: L41680 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase isoform a.
 
 

Transcript original information
Accession number L41680.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ST8SIA4) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ST8SIA4);
Sequence data provider NA
Annotation project NA
Length of cDNA 1894[bp] (No. of exon:5)[A:592 T:507 G:418 C:377]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type fetal brain
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0005064
Genomic location  G-integra Help Chromosome 5
Location 5q21.1
Position 100146949- 100238871
Strand -
Possible duplicated location(s) NA
Gene structure 5 exon(s)
Database links RefSeq NM_005668NM_175052
Ensembl ENST00000231461ENST00000451528ENST00000507360ENST00000523381
Entrez Gene Entrez Gene ID:7903
KEGG GENES KEGG GENES(7903)
GeneCard GeneCardST8SIA4*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000094442
Predicted CDS 213..1292;  359[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.707
Database links RefSeq NP_005659
UniProt P61645Q92187
CCDS CCDS4091

Motif information
ORF

length(359),orf(213:1292)
MRSIRKRWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVN
SSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKS
SFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGI
LLDSECGKEIDSHNFVIRCNLAPVVEFAADVGTKSDFITMNPSVVQRAFG
GFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNALILKNKLK
VRTAYPSLRLIHAVRGYWLTNKVPIKRPSTGLLMYTLATRFCDEIHLYGF
WPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALK
LTTGKCVKQ*
a.a.
length
InterPro Name
length(357), motif(1:357) 357 IPR012163 Sialyltransferase [Family]
length(264), motif(92:355) 264 IPR001675 Glycosyl transferase, family 29 [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000193787
H-Inv cluster ID Locus viewHIX0005064
Accession number L41680.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase isoform a.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_005659)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID HIF0000663
Gene family/group name Sialyltransferase (IPR012163).
Evidence motif (InterPro) ID IPR012163
Gene symbol/name HGNC symbol ST8SIA4
HGNC aliases "sialyltransferase 8 (alpha-2, 8-polysialytransferase) D"
HGNC name ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
DDBJ PST
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000094442
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NM_005668NM_175052
Ensembl ENST00000231461ENST00000451528ENST00000507360ENST00000523381
Entrez Gene Entrez Gene ID:7903
KEGG GENES KEGG GENES(7903)
GeneCard GeneCardST8SIA4*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Sialyltransferase (IPR012163). Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function sialyltransferase activity (GO:0008373); 
Biological process protein amino acid glycosylation (GO:0006486); 
Cellular component integral to Golgi membrane (GO:0030173); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT mitochondria;  cytosol;  nuclear;  Other; 
Target P signal peptide
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA020716; 
Affymetrix
GeneChip
HG-Focus 206925_at; 
HG-U133 206925_at; 
HG-U133A 206925_at; 
HG-U133A_2 206925_at; 
HG-U133B NA
HG-U133_Plus_2 206925_at; 
HG-U95 33649_at; 
HG-U95A 33649_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2868914;  2868915;  2868916;  2868917;  2868918;  2868938;  2868939;  2868940;  2868944;  2868946;  2868951;  2868952;  2868953;  2868954; 
HuGeneFL L41680_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P41693; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P361984; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  601888608850611091612554612571
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(7903)
Disease Entrez Gene ID:(7903)
Substance Entrez Gene ID:(7903)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
71 .. 71 T/C rs1428439 - 5'UTR
79 .. 79 T/A rs77888994 - 5'UTR
149 .. 149 G/T rs28617677 - 5'UTR
563 .. 563 A/T rs111610860 - CDS Synonymous[Thr117Thr]
1431 .. 1431 A/G rs113309201 - 3'UTR
1444 .. 1444 G/A rs3076 - 3'UTR
1633 .. 1633 T/C rs10075853 - 3'UTR
1808 ^ 1809 -/T rs3842024 - 3'UTR
1817 ^ 1818 -/T rs33919201 - 3'UTR
1820 .. 1820 G/T rs77924520 - 3'UTR
1822 .. 1822 C/T rs116087627 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer