H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000193587 Accession number: L39957 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to Ig kappa chain V-I region HK102; Precursor; Fragment;
 
 

Motif information
ORF

length(108),orf(1:324)
DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYK
ASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYPYTFGQ
GTKLEIKR
a.a.
length
InterPro Name
length(104), motif(2:105) 104 IPR013106 Immunoglobulin V-set [Domain]
length(88), motif(2:89) 88 IPR007110 Immunoglobulin-like [Domain]
length(105), motif(3:107) 105 IPR013783 Immunoglobulin-like fold [Domain]
length(100), motif(8:107) 100 IPR003599 Immunoglobulin subtype [Domain]
length(73), motif(18:90) 73 IPR003596 Immunoglobulin V-set, subgroup [Domain]