H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000098026_03 Accession number: BC045533 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Golgi resident protein GCP60; Acyl-CoA-binding domain-containing protein 3; Golgi complex-associated protein 1; GOCAP1; Golgi phosphoprotein 1; GOLPH1; PBR- and PKA-associated protein 7; Peripheral benzodiazepine receptor-associated protein PAP7;
 
 

Transcript original information
Accession number BC045533.1
CAGE tag ID NA
EST ID NA
Clone Number MGC:57123 IMAGE:5259930
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ACBD3) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ACBD3);
Sequence data provider NA
Annotation project NA
Length of cDNA 3560[bp] (No. of exon:8)[A:1059 T:1020 G:820 C:661]
Devision NA
Molecular type NA
Library origin Cell type NA
Tissue type Brain, hippocampus
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 3546(+) Signal: 3527-3531(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001643
Genomic location  G-integra Help Chromosome 1
Location 1q42.12
Position 226332382- 226374409
Strand -
Possible duplicated location(s) NA
Gene structure 8 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:64746
KEGG GENES KEGG GENES(64746)
GeneCard GeneCardACBD3*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000024076
Predicted CDS 34..1620;  528[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.742
Database links RefSeq NP_073572
UniProt Q9H3P7
CCDS CCDS1551

Motif information
ORF

length(528),orf(34:1620)
MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRG
PGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGK
AFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALG
NMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRRE
EEERERLQKEEEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAAL
NSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQ
QAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELE
PEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRG
EVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSES
SDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPG
RGVYLLKFDNSYSLWRSKSVYYRVYYTR*
a.a.
length
InterPro Name
length(92), motif(83:174) 92 IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle [Domain]
length(88), motif(83:170) 88 IPR000582 Acyl-CoA-binding protein, ACBP [Domain]
length(92), motif(83:174) 92 IPR000582 Acyl-CoA-binding protein, ACBP [Domain]
length(88), motif(84:171) 88 IPR000582 Acyl-CoA-binding protein, ACBP [Domain]
length(19), motif(104:122) 19 IPR022408 Acyl-CoA-binding protein, ACBP, conserved site [Conserved_site]
length(143), motif(384:526) 143 IPR009038 GOLD [Domain]
length(55), motif(390:444) 55 IPR009038 GOLD [Domain]
length(131), motif(397:527) 131 IPR009038 GOLD [Domain]
length(53), motif(475:527) 53 IPR009038 GOLD [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000098026_03
H-Inv cluster ID Locus viewHIX0001643
Accession number BC045533.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Golgi resident protein GCP60; Acyl-CoA-binding domain-containing protein 3; Golgi complex-associated protein 1; GOCAP1; Golgi phosphoprotein 1; GOLPH1; PBR- and PKA-associated protein 7; Peripheral benzodiazepine receptor-associated protein PAP7;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q9H3P7)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 115901811266580114702039154893341671041418691976196903322006823121269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ACBD3
HGNC aliases "golgi complex associated protein 1, 60kDa", "acyl-Coenzyme A binding domain containing 3"
HGNC name acyl-CoA binding domain containing 3
DDBJ ACBD3
UniProt ACBD3
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000024076
No. of interaction 25
Interaction partner(s) HIP000021834HIP000023033HIP000025295HIP000028585HIP000028785HIP000028936HIP000029584HIP000047440HIP000049733HIP000054007HIP000055792HIP000057104HIP000060896HIP000066454HIP000066511HIP000072624HIP000072624HIP000077623HIP000088671HIP000091231HIP000091335HIP000091335HIP000095713HIP000097882HIP000103500
BIND 150193; 
DIP NA
MINT MINT-61799; 
HPRD 03933;  03990;  06901; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:64746
KEGG GENES KEGG GENES(64746)
GeneCard GeneCardACBD3*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function acyl-CoA binding (GO:0000062); 
Biological process transport (GO:0006810); 
Cellular component integral to membrane (GO:0016021); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
8 .. 8 C/A rs185630727 - 5'UTR
21 .. 21 G/A rs200337750 - 5'UTR
54 .. 54 A/T rs77797743 - CDS Synonymous[Ala7Ala]
493 .. 493 A/G rs143911859 - CDS Nonsynonymous[Lys154Glu]
585 .. 585 A/G rs149088607 - CDS Synonymous[Glu184Glu]
593 ^ 594 -/C rs111701159 - CDS
594 .. 594 A/C rs2306120 - CDS Nonsynonymous[Glu187Asp]
612 .. 612 A/T rs9730340 - CDS Nonsynonymous[Glu193Asp]
673 .. 673 C/T/G rs112143123 - CDS
674 .. 674 G/A rs147538215 - CDS Nonsynonymous[Arg214His]
696 .. 696 G/C rs191893895 - CDS Nonsynonymous[Arg221Ser]
718 .. 718 A/C rs78919255 - CDS Synonymous[Arg229Arg]
719 .. 719 G/C rs77727776 - CDS Nonsynonymous[Arg229Thr]
725 .. 725 G/A rs145831627 - CDS Nonsynonymous[Arg231Gln]
741 .. 741 G/C rs149848847 - CDS Nonsynonymous[Arg236Ser]
799 .. 799 G/A rs200702189 - CDS Nonsynonymous[Val256Met]
822 .. 822 C/T rs149492799 - CDS Synonymous[Ala263Ala]
906 .. 906 G/A rs180969293 - CDS Synonymous[Gln291Gln]
930 .. 930 G/A rs141482742 - CDS Synonymous[Gln299Gln]
959 .. 959 A/G rs137989799 - CDS Nonsynonymous[Glu309Gly]
976 .. 976 T/G rs199935319 - CDS Nonsynonymous[Ser315Ala]
1009 .. 1009 A/C rs186444053 - CDS Nonsynonymous[Thr326Pro]
1025 .. 1025 T/C rs141535126 - CDS Nonsynonymous[Met331Thr]
1097 .. 1097 A/G rs144925748 - CDS Nonsynonymous[Glu355Gly]
1100 .. 1100 A/C rs143544007 - CDS Nonsynonymous[Glu356Ala]
1117 .. 1117 C/T rs199621655 - CDS Nonsynonymous[Pro362Ser]
1121 .. 1121 A/G rs189746293 - CDS Nonsynonymous[Lys363Arg]
1206 .. 1206 A/T rs201230026 - CDS Synonymous[Ala391Ala]
1210 .. 1210 T/G rs148868431 - CDS Nonsynonymous[Ser393Ala]
1212 .. 1212 C/T rs114674626 - CDS Synonymous[Ser393Ser]
1263 .. 1263 T/C rs200054927 - CDS Synonymous[His410His]
1278 .. 1278 T/C rs147875428 - CDS Synonymous[Tyr415Tyr]
1304 .. 1304 A/G rs150683627 - CDS Nonsynonymous[Asn424Ser]
1311 .. 1311 C/T rs149458367 - CDS Synonymous[Asp426Asp]
1321 .. 1321 G/A rs142934805 - CDS Nonsynonymous[Gly430Arg]
1323 .. 1323 G/A rs201959552 - CDS Synonymous[Gly430Gly]
1398 .. 1398 G/C rs201638495 - CDS Nonsynonymous[Glu455Asp]
1416 .. 1416 C/T rs146216214 - CDS Synonymous[Ile461Ile]
1451 .. 1451 A/G rs17855715 - CDS Nonsynonymous[Lys473Arg]
1503 .. 1503 G/T rs3211100 + CDS Nonsynonymous[Glu490Asp]
1564 .. 1564 T/C rs113333885 - CDS Nonsynonymous[Ser511Pro]
1641 .. 1641 G/A rs41304002 - 3'UTR
1647 .. 1647 A/T rs1062716 + 3'UTR
1846 .. 1846 A/G rs111803808 - 3'UTR
1934 .. 1934 C/T rs146253707 - 3'UTR
2002 .. 2002 G/A rs61835249 - 3'UTR
2151 .. 2151 C/G rs143479832 - 3'UTR
2165 .. 2165 C/A rs61835248 - 3'UTR
2368 .. 2368 G/A rs190204079 - 3'UTR
2401 .. 2401 G/A rs187412894 - 3'UTR
2551 .. 2551 A/G rs182224919 - 3'UTR
2562 .. 2562 A/G rs41314288 - 3'UTR
2726 .. 2726 C/T rs41304004 - 3'UTR
2933 .. 2933 G/A rs1043641 + 3'UTR
2942 .. 2942 A/T rs189233972 - 3'UTR
3082 .. 3082 A/C rs150591263 - 3'UTR
3106 .. 3106 C/A rs183521976 - 3'UTR
3231 ^ 3232 -/T rs35794165 - 3'UTR
3234 ^ 3235 -/T rs138447017 - 3'UTR
3272 .. 3272 T/G rs191189456 - 3'UTR
3281 .. 3281 A/C rs188671316 - 3'UTR
3455 .. 3455 T/C rs183942858 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer