H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000095824 Accession number: BC039575 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Golgi resident protein GCP60; Acyl-CoA-binding domain-containing protein 3; Golgi complex-associated protein 1; GOCAP1; Golgi phosphoprotein 1; GOLPH1; PBR- and PKA-associated protein 7; Peripheral benzodiazepine receptor-associated protein PAP7;
 
 

Transcript original information
Accession number BC039575.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:5725757
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (ACBD3) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (ACBD3);
Sequence data provider NA
Annotation project NA
Length of cDNA 1994[bp] (No. of exon:8)[A:627 T:406 G:549 C:412]
Devision HTC
Molecular type mRNA
Library origin Cell type NA
Tissue type Ovary, pooled from 3 adults
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1930(+) Signal: 1905-1909(+)
Vector/adapter sequence NA
Frame shift 594-594[bp] Insertion(A);
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001643
Genomic location  G-integra Help Chromosome 1
Location 1q42.12
Position 226333994- 226374401
Strand -
Possible duplicated location(s) NA
Gene structure 8 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:64746
KEGG GENES KEGG GENES(64746)
GeneCard GeneCardACBD3*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000024076
Predicted CDS 26..1612;  528[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.743
Database links RefSeq NP_073572
UniProt Q9H3P7
CCDS CCDS1551

Motif information
ORF

length(528),orf(26:1612)
MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRG
PGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGK
AFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALG
NMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRRE
EEERERLQKEEEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAAL
NSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQ
QAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELE
PEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRG
EVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSES
SDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPG
RGVYLLKFDNSYSLWRSKSVYYRVYYTR*
a.a.
length
InterPro Name
length(92), motif(83:174) 92 IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle [Domain]
length(88), motif(83:170) 88 IPR000582 Acyl-CoA-binding protein, ACBP [Domain]
length(92), motif(83:174) 92 IPR000582 Acyl-CoA-binding protein, ACBP [Domain]
length(88), motif(84:171) 88 IPR000582 Acyl-CoA-binding protein, ACBP [Domain]
length(19), motif(104:122) 19 IPR022408 Acyl-CoA-binding protein, ACBP, conserved site [Conserved_site]
length(143), motif(384:526) 143 IPR009038 GOLD [Domain]
length(55), motif(390:444) 55 IPR009038 GOLD [Domain]
length(131), motif(397:527) 131 IPR009038 GOLD [Domain]
length(53), motif(475:527) 53 IPR009038 GOLD [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000095824
H-Inv cluster ID Locus viewHIX0001643
Accession number BC039575.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Similar to Golgi resident protein GCP60; Acyl-CoA-binding domain-containing protein 3; Golgi complex-associated protein 1; GOCAP1; Golgi phosphoprotein 1; GOLPH1; PBR- and PKA-associated protein 7; Peripheral benzodiazepine receptor-associated protein PAP7;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (Q9H3P7)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 115901811266580114702039154893341671041418691976196903322006823121269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol ACBD3
HGNC aliases "golgi complex associated protein 1, 60kDa", "acyl-Coenzyme A binding domain containing 3"
HGNC name acyl-CoA binding domain containing 3
DDBJ NA
UniProt ACBD3
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000024076
No. of interaction 25
Interaction partner(s) HIP000021834HIP000023033HIP000025295HIP000028585HIP000028785HIP000028936HIP000029584HIP000047440HIP000049733HIP000054007HIP000055792HIP000057104HIP000060896HIP000066454HIP000066511HIP000072624HIP000072624HIP000077623HIP000088671HIP000091231HIP000091335HIP000091335HIP000095713HIP000097882HIP000103500
BIND 150193; 
DIP NA
MINT MINT-61799; 
HPRD 03933;  03990;  06901; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:64746
KEGG GENES KEGG GENES(64746)
GeneCard GeneCardACBD3*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function acyl-CoA binding (GO:0000062); 
Biological process transport (GO:0006810); 
Cellular component integral to membrane (GO:0016021); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
83 172 1hbkA 5e-14 17.4 86/89 a.11.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA060117; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 202323_s_at; 
HG-U133A 202323_s_at; 
HG-U133A_2 202323_s_at; 
HG-U133B NA
HG-U133_Plus_2 202323_s_at; 
HG-U95 89155_at; 
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E 89155_at; 
HG-U95Av2 NA
HuEx-1_0 2383111;  2458706;  2458707;  2458710;  2458712;  2458714;  2458715;  2458716;  2458717;  2458718;  2458721;  2458722;  2458723;  2458724; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 NA
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
13 .. 13 G/A rs200337750 - 5'UTR
46 .. 46 A/T rs77797743 - CDS Synonymous[Ala7Ala]
485 .. 485 A/G rs143911859 - CDS Nonsynonymous[Lys154Glu]
577 .. 577 A/G rs149088607 - CDS Synonymous[Glu184Glu]
585 ^ 586 -/C rs111701159 - CDS
586 .. 586 A/C rs2306120 - CDS Nonsynonymous[Glu187Asp]
604 .. 604 A/T rs9730340 - CDS Nonsynonymous[Glu193Asp]
665 .. 665 C/T/G rs112143123 - CDS
666 .. 666 G/A rs147538215 - CDS Nonsynonymous[Arg214His]
688 .. 688 G/C rs191893895 - CDS Nonsynonymous[Arg221Ser]
710 .. 710 A/C rs78919255 - CDS Synonymous[Arg229Arg]
711 .. 711 G/C rs77727776 - CDS Nonsynonymous[Arg229Thr]
717 .. 717 G/A rs145831627 - CDS Nonsynonymous[Arg231Gln]
733 .. 733 G/C rs149848847 - CDS Nonsynonymous[Arg236Ser]
791 .. 791 G/A rs200702189 - CDS Nonsynonymous[Val256Met]
814 .. 814 C/T rs149492799 - CDS Synonymous[Ala263Ala]
898 .. 898 G/A rs180969293 - CDS Synonymous[Gln291Gln]
922 .. 922 G/A rs141482742 - CDS Synonymous[Gln299Gln]
951 .. 951 A/G rs137989799 - CDS Nonsynonymous[Glu309Gly]
968 .. 968 T/G rs199935319 - CDS Nonsynonymous[Ser315Ala]
1001 .. 1001 A/C rs186444053 - CDS Nonsynonymous[Thr326Pro]
1017 .. 1017 T/C rs141535126 - CDS Nonsynonymous[Met331Thr]
1089 .. 1089 A/G rs144925748 - CDS Nonsynonymous[Glu355Gly]
1092 .. 1092 A/C rs143544007 - CDS Nonsynonymous[Glu356Ala]
1109 .. 1109 C/T rs199621655 - CDS Nonsynonymous[Pro362Ser]
1113 .. 1113 A/G rs189746293 - CDS Nonsynonymous[Lys363Arg]
1198 .. 1198 A/T rs201230026 - CDS Synonymous[Ala391Ala]
1202 .. 1202 T/G rs148868431 - CDS Nonsynonymous[Ser393Ala]
1204 .. 1204 C/T rs114674626 - CDS Synonymous[Ser393Ser]
1255 .. 1255 T/C rs200054927 - CDS Synonymous[His410His]
1270 .. 1270 T/C rs147875428 - CDS Synonymous[Tyr415Tyr]
1296 .. 1296 A/G rs150683627 - CDS Nonsynonymous[Asn424Ser]
1303 .. 1303 C/T rs149458367 - CDS Synonymous[Asp426Asp]
1313 .. 1313 G/A rs142934805 - CDS Nonsynonymous[Gly430Arg]
1315 .. 1315 G/A rs201959552 - CDS Synonymous[Gly430Gly]
1390 .. 1390 G/C rs201638495 - CDS Nonsynonymous[Glu455Asp]
1408 .. 1408 C/T rs146216214 - CDS Synonymous[Ile461Ile]
1443 .. 1443 A/G rs17855715 - CDS Nonsynonymous[Lys473Arg]
1495 .. 1495 G/T rs3211100 + CDS Nonsynonymous[Glu490Asp]
1556 .. 1556 T/C rs113333885 - CDS Nonsynonymous[Ser511Pro]
1633 .. 1633 G/A rs41304002 - 3'UTR
1639 .. 1639 A/T rs1062716 + 3'UTR
1838 .. 1838 A/G rs111803808 - 3'UTR
1926 .. 1926 C/T rs146253707 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer