H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000065583 Accession number: AF067855 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Geminin;
 
 

Transcript original information
Accession number AF067855.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (GMNN) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (GMNN);
Sequence data provider NA
Annotation project NA
Length of cDNA 961[bp] (No. of exon:6)[A:342 T:264 G:196 C:158]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 952(+) Signal: 924-928(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature Truncation; 
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0005629
Genomic location  G-integra Help Chromosome 6
Location 6p22.3
Position 24777450- 24786324
Strand +
Possible duplicated location(s) NA
Gene structure 6 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:51053
KEGG GENES KEGG GENES(51053)
GeneCard GeneCardGMNN*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000081148
Predicted CDS 26..655;  209[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.732

Motif information
ORF

length(209),orf(26:655)
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASXSLVGRENELSAGLSK
RKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK
EVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQY
MAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVS
SSTDAKPCI*
a.a.
length
InterPro Name
length(190), motif(1:190) 190 IPR022786 Geminin/Multicilin [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000065583
H-Inv cluster ID Locus viewHIX0005629
Accession number AF067855.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Geminin;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (O75496)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 963543314574404147020391499321215260975153136231537803415489334186696481960886119906994200682312154333222615398ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol GMNN
HGNC aliases NA
HGNC name geminin, DNA replication inhibitor
DDBJ NA
UniProt GMNN
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000081148
No. of interaction 63
Interaction partner(s) HIP000007307HIP000022804HIP000023102HIP000023359HIP000023396HIP000023668HIP000029400HIP000030402HIP000035983HIP000036924HIP000037118HIP000039147HIP000042131HIP000044061HIP000045632HIP000046719HIP000049460HIP000058372HIP000060149HIP000060819HIP000063011HIP000063736HIP000064438HIP000066389HIP000068463HIP000070318HIP000071861HIP000071861HIP000071893HIP000074595HIP000084045HIP000087515HIP000088104HIP000090502HIP000091162HIP000091335HIP000091388HIP000091827HIP000092457HIP000095236HIP000095713HIP000096018HIP000097326HIP000097970HIP000098053HIP000098480HIP000099330HIP000099471HIP000101710HIP000102908HIP000102908HIP000103018HIP000106320HIP000107459HIP000109810HIP000119302HIP000120501HIP000145143HIP000208864HIP000213989HIP000214315HIP000354903HIP000359960
BIND 134165;  134218;  134226;  134271;  58003; 
DIP 60547E; 
MINT MINT-1955603;  MINT-4508819;  MINT-4508837;  MINT-50424;  MINT-50443;  MINT-50444;  MINT-50445; 
HPRD 00298;  00838;  00845;  00846;  00850;  00856;  00857;  00867;  01990;  02542;  03485;  04756;  06900;  11381;  11540;  16009; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:51053
KEGG GENES KEGG GENES(51053)
GeneCard GeneCardGMNN*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Biological process regulation of DNA replication (GO:0006275); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol;  extracellular; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA210711; 
Affymetrix
GeneChip
HG-Focus 218350_s_at; 
HG-U133 218350_s_at; 
HG-U133A 218350_s_at; 
HG-U133A_2 218350_s_at; 
HG-U133B NA
HG-U133_Plus_2 218350_s_at; 
HG-U95 49176_at;  53205_at;  63535_at; 
HG-U95A NA
HG-U95B 49176_at;  53205_at; 
HG-U95C 63535_at; 
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2898610;  2898611;  2898614;  2898617;  2898622;  2898624;  2898625;  2898626;  2898627;  2898628;  2945717; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P19712; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P19712; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
17 .. 17 A/G rs148482261 + 5'UTR
68 .. 68 A/C rs34891389 + CDS Nonsynonymous[Asn15His]
78 .. 78 A/C rs1923185 + CDS Nonsynonymous[Asn18Thr]
133 .. 133 T/C rs199520244 + CDS Synonymous[Ser36Ser]
161 .. 161 G/T rs150391376 + CDS Nonsynonymous[Ala46Ser]
169 .. 169 G/C rs2307307 + CDS Nonsynonymous[Leu48Phe]
185 .. 185 C/T rs2307306 + CDS Nonsynonymous[Arg54Trp]
203 .. 203 T/C rs2307302 + CDS Nonsynonymous[Ser60Pro]
259 .. 259 T/C rs138954355 + CDS Synonymous[Leu78Leu]
278 .. 278 T/C rs113023646 + CDS Nonsynonymous[Ser85Pro]
291 .. 291 T/C rs142110012 + CDS Nonsynonymous[Met89Thr]
332 .. 332 G/T rs201832727 + CDS Nonsynonymous[Ala103Ser]
352 .. 352 G/A rs145822661 + CDS Synonymous[Ala109Ala]
378 .. 378 A/G rs202155543 + CDS Nonsynonymous[Glu118Gly]
423 .. 423 G/A rs201577150 + CDS Nonsynonymous[Arg133His]
431 .. 431 A/G rs199710640 + CDS Nonsynonymous[Lys136Glu]
450 .. 450 C/A rs201212043 + CDS Nonsynonymous[Ala142Glu]
465 .. 465 A/G rs138555209 + CDS Nonsynonymous[His147Arg]
488 .. 488 A/G rs201007411 + CDS Nonsynonymous[Ile155Val]
526 .. 526 A/T rs141209716 + CDS Nonsynonymous[Glu167Asp]
633 .. 633 C/T rs2307303 + CDS Nonsynonymous[Thr203Met]
693 .. 693 G/A rs199526802 + 3'UTR
735 .. 735 A/G rs1802380 + 3'UTR
798 .. 798 T/C rs187593968 + 3'UTR
899 .. 899 C/T rs2307309 + 3'UTR
951 .. 951 G/A rs3173458 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer