H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000061459 Accession number: AB087802 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Uridine diphosphate glucose pyrophosphatase; UDPG pyrophosphatase; UGPPase; EC=3.6.1.45; Nucleoside diphosphate-linked moiety X motif 14; Nudix motif 14;
 
 

Motif information
ORF

length(222),orf(1:669)
MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNS
SRRSLVLVKQFRPAVYAGEVERRFPGSLAAVDQDGPRELQPALPGSAGVT
VELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGVGLTG
SRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPK
TLGVIFGVSWFLSQVAPNLDLQ*
a.a.
length
InterPro Name
length(211), motif(4:214) 211 IPR015797 NUDIX hydrolase domain-like [Domain]
length(194), motif(13:206) 194 IPR015797 NUDIX hydrolase domain-like [Domain]
length(190), motif(17:206) 190 IPR004385 Nucleoside diphosphate pyrophosphatase [Family]
length(169), motif(38:206) 169 IPR000086 NUDIX hydrolase domain [Domain]
length(162), motif(40:201) 162 IPR000086 NUDIX hydrolase domain [Domain]