H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000061459 Accession number: AB087802 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Uridine diphosphate glucose pyrophosphatase.
 
 

Motif information
ORF

length(222),orf(1:669)
MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNS
SRRSLVLVKQFRPAVYAGEVERRFPGSLAAVDQDGPRELQPALPGSAGVT
VELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGVGLTG
SRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPK
TLGVIFGVSWFLSQVAPNLDLQ*
a.a.
length
InterPro Name
length(212), motif(1:212) 212 IPR004385 Nucleoside diphosphate pyrophosphatase [Family]
length(218), motif(2:219) 218 IPR000086 NUDIX hydrolase domain [Domain]
length(215), motif(3:217) 215 IPR015797 NUDIX hydrolase domain-like [Domain]
length(162), motif(40:201) 162 IPR000086 NUDIX hydrolase domain [Domain]