H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000061459 Accession number: AB087802 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Uridine diphosphate glucose pyrophosphatase; UDPG pyrophosphatase; UGPPase; EC=3.6.1.45; Nucleoside diphosphate-linked moiety X motif 14; Nudix motif 14;
 
 

Transcript original information
Accession number AB087802.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (NUDT14) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (NUDT14);
Sequence data provider NA
Annotation project NA
Length of cDNA 780[bp] (No. of exon:5)[A:160 T:144 G:245 C:231]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Tyroid gland
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 751(+) Signal: 730-734(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0202090
Genomic location  G-integra Help Chromosome 14
Location 14q32.33
Position 105639276- 105647546
Strand -
Possible duplicated location(s) NA
Gene structure 5 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:256281
KEGG GENES KEGG GENES(256281)
GeneCard GeneCardNUDT14*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000049917
Predicted CDS 1..669;  222[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.805
Database links RefSeq NP_803877
UniProt O95848
CCDS CCDS10000

Motif information
ORF

length(222),orf(1:669)
MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNS
SRRSLVLVKQFRPAVYAGEVERRFPGSLAAVDQDGPRELQPALPGSAGVT
VELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGVGLTG
SRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPK
TLGVIFGVSWFLSQVAPNLDLQ*
a.a.
length
InterPro Name
length(211), motif(4:214) 211 IPR015797 NUDIX hydrolase domain-like [Domain]
length(194), motif(13:206) 194 IPR015797 NUDIX hydrolase domain-like [Domain]
length(190), motif(17:206) 190 IPR004385 Nucleoside diphosphate pyrophosphatase [Family]
length(169), motif(38:206) 169 IPR000086 NUDIX hydrolase domain [Domain]
length(162), motif(40:201) 162 IPR000086 NUDIX hydrolase domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000061459
H-Inv cluster ID Locus viewHIX0202090
Accession number AB087802.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Uridine diphosphate glucose pyrophosphatase; UDPG pyrophosphatase; UGPPase; EC=3.6.1.45; Nucleoside diphosphate-linked moiety X motif 14; Nudix motif 14;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (O95848)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 10662552124290231250812115489334ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NUDT14
HGNC aliases NA
HGNC name nudix (nucleoside diphosphate linked moiety X)-type motif 14
DDBJ UGPP
UniProt NUDT14
EC number EC 3.6.1.45UDP-sugar diphosphatase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000049917
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:256281
KEGG GENES KEGG GENES(256281)
GeneCard GeneCardNUDT14*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function metal ion binding (GO:0046872);  hydrolase activity (GO:0016787);  hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides (GO:0016818); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT cytosol;  nuclear;  extracellular; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
28 159 1v8iA 2e-11 29.5 95/150 d.113.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 231910_at;  231914_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 231910_at;  231914_at; 
HG-U133_Plus_2 231910_at;  231914_at; 
HG-U95 50425_at; 
HG-U95A NA
HG-U95B 50425_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3581486;  3581487;  3581488;  3581492;  3581494;  3581495;  3581497;  3581498; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P414974; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P414978;  A_32_P5976; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
41 .. 41 C/T rs17095304 + CDS Nonsynonymous[Ala14Val]
96 .. 96 G/C rs150509138 - CDS Nonsynonymous[Lys32Asn]
133 .. 133 G/A rs141645903 - CDS Nonsynonymous[Val45Ile]
136 .. 136 C/A rs148004115 - CDS Nonsynonymous[Leu46Ile]
138 .. 138 C/T rs144476189 - CDS Synonymous[Leu46Leu]
154 .. 154 C/T rs142762135 - CDS Nonsynonymous[Arg52Trp]
218 .. 218 G/A rs148480421 - CDS Nonsynonymous[Arg73His]
253 .. 253 G/A rs144645678 - CDS Nonsynonymous[Gly85Arg]
282 .. 282 C/T rs117624322 - CDS Synonymous[Pro94Pro]
283 .. 283 G/A rs141847132 - CDS Nonsynonymous[Gly95Ser]
291 .. 291 G/A rs200578196 - CDS Synonymous[Ala97Ala]
316 .. 316 G/A rs138979378 - CDS Nonsynonymous[Gly106Ser]
321 .. 321 C/T rs150187377 - CDS Synonymous[Leu107Leu]
386 .. 386 A/C rs201161191 - CDS Nonsynonymous[Tyr129Ser]
436 .. 436 G/A rs140954836 - CDS Nonsynonymous[Val146Met]
443 .. 443 T/A rs151042482 - CDS Nonsynonymous[Leu148Gln]
445 .. 445 A/T rs144243661 - CDS Nonsynonymous[Thr149Ser]
493 .. 493 C/T rs201834263 - CDS Nonsynonymous[Arg165Cys]
564 .. 564 C/T rs140616526 - CDS Synonymous[Gly188Gly]
582 .. 582 C/T rs146723092 - CDS Synonymous[Asp194Asp]
609 .. 609 C/T rs200409369 - CDS Synonymous[Gly203Gly]
612 .. 612 C/A rs143429356 - CDS Synonymous[Val204Val]
670 .. 670 G/C rs148685373 - 3'UTR
671 .. 671 A/G rs116285474 - 3'UTR
713 .. 713 C/T rs201967340 - 3'UTR
749 .. 749 C/T rs115869881 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer