H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000061459 Accession number: AB087802 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Uridine diphosphate glucose pyrophosphatase.
 
 

Transcript original information
Accession number AB087802.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (NUDT14) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (NUDT14);
Sequence data provider NA
Annotation project NA
Length of cDNA 780[bp] (No. of exon:5)[A:160 T:144 G:245 C:231]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Tyroid gland
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 751(+) Signal: 730-734(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0202090
Genomic location  G-integra Help Chromosome 14
Location NA
Position 105639276- 105647546
Strand -
Possible duplicated location(s) NA
Gene structure 5 exon(s)
Database links RefSeq NM_177533
Ensembl ENST00000339418ENST00000392568ENST00000535832
Entrez Gene Entrez Gene ID:256281
KEGG GENES KEGG GENES(256281)
GeneCard GeneCardNUDT14*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000049917
Predicted CDS 1..669;  222[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.805
Database links RefSeq NP_803877
UniProt O95848
CCDS CCDS10000

Motif information
ORF

length(222),orf(1:669)
MERIEGASVGRCAASPYLRPLTLHYRQNGAQKSWDFMKTHDSVTVLLFNS
SRRSLVLVKQFRPAVYAGEVERRFPGSLAAVDQDGPRELQPALPGSAGVT
VELCAGLVDQPGLSLEEVACKEAWEECGYHLAPSDLRRVATYWSGVGLTG
SRQTMFYTEVTDAQRSGPGGGLVEEGELIEVVHLPLEGAQAFADDPDIPK
TLGVIFGVSWFLSQVAPNLDLQ*
a.a.
length
InterPro Name
length(212), motif(1:212) 212 IPR004385 Nucleoside diphosphate pyrophosphatase [Family]
length(218), motif(2:219) 218 IPR000086 NUDIX hydrolase domain [Domain]
length(215), motif(3:217) 215 IPR015797 NUDIX hydrolase domain-like [Domain]
length(162), motif(40:201) 162 IPR000086 NUDIX hydrolase domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000061459
H-Inv cluster ID Locus viewHIX0202090
Accession number AB087802.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Uridine diphosphate glucose pyrophosphatase.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_803877)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NUDT14
HGNC aliases NA
HGNC name nudix (nucleoside diphosphate linked moiety X)-type motif 14
DDBJ UGPP
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000049917
No. of interaction 2
Interaction partner(s) HIP000046889HIP000049156
BIND NA
DIP NA
MINT NA
HPRD 01265;  02405; 
IntAct EBI-536992;  EBI-537062;  EBI-537132;  EBI-537279; 
Database links RefSeq NM_177533
Ensembl ENST00000339418ENST00000392568ENST00000535832
Entrez Gene Entrez Gene ID:256281
KEGG GENES KEGG GENES(256281)
GeneCard GeneCardNUDT14*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function metal ion binding (GO:0046872);  hydrolase activity (GO:0016787);  hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides (GO:0016818); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT cytosol;  nuclear;  extracellular; 
Target P Not predicted
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:26-Mar-2013
Start End PDB_ID E-value Identity Coverage SCOP_ID
28 159 1v8iA 2e-11 29.5 95/150 d.113.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 231910_at;  231914_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 231910_at;  231914_at; 
HG-U133_Plus_2 231910_at;  231914_at; 
HG-U95 50425_at; 
HG-U95A NA
HG-U95B 50425_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3581486;  3581487;  3581488;  3581492;  3581494;  3581495;  3581497;  3581498; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P414974; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P414978;  A_32_P5976; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
41 .. 41 C/T rs17095304 + CDS Nonsynonymous[Ala14Val]
282 .. 282 C/T rs117624322 - CDS Synonymous[Pro94Pro]
671 .. 671 A/G rs116285474 - 3'UTR
749 .. 749 C/T rs115869881 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer