H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000059351 Accession number: AB043587 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Golgi resident protein GCP60.
 
 

Motif information
ORF

length(528),orf(56:1642)
MAAVLNAERLEVSVDGLTLSPDPEERPGAEGAPLLPPPLPPPSPPGSGRG
PGASGEQPEPGEAAAGGAAEEARRLEQRWGFGLEELYGLALRFFKEKDGK
AFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALG
NMSKEDAMVEFVKLLNRCCHLFSTYVASHKIEKEEQEKKRKEEEERRRRE
EEERERLQKEEEKRRREEEERLRREEEERRRIEEERLRLEQQKQQIMAAL
NSQTAVQFQQYAAQQYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQ
QAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELE
PEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVITVGRG
EVVTVRVPTHEEGSYLFWEFATDNYDIGFGVYFEWTDSPNTAVSVHVSES
SDDDEEEEENIGCEEKAKKNANKPLLDEIVPVYRRDCHEEVYAGSHQYPG
RGVYLLKFDNSYSLWRSKSVYYRVYYTR*
a.a.
length
InterPro Name
length(93), motif(82:174) 93 IPR000582 Acyl-CoA-binding protein, ACBP [Domain]
length(93), motif(83:175) 93 IPR014352 FERM/acyl-CoA-binding protein, 3-helical bundle [Domain]
length(92), motif(83:174) 92 IPR000582 Acyl-CoA-binding protein, ACBP [Domain]
length(88), motif(84:171) 88 IPR000582 Acyl-CoA-binding protein, ACBP [Domain]
length(19), motif(104:122) 19 IPR022408 Acyl-CoA-binding protein, ACBP, conserved site [Conserved_site]
length(143), motif(384:526) 143 IPR009038 GOLD [Domain]
length(140), motif(388:527) 140 IPR009038 GOLD [Domain]