H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000059328 Accession number: AB042410 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to Uncharacterized protein;
 
 

Transcript original information
Accession number AB042410.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (GPR88) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (GPR88);
Sequence data provider NA
Annotation project NA
Length of cDNA 3517[bp] (No. of exon:2)[A:807 T:888 G:849 C:973]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 3484(+) Signal: 3472-3476(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0028498
Genomic location  G-integra Help Chromosome 1
Location 1p21.2
Position 101003693- 101007571
Strand +
Possible duplicated location(s) NA
Gene structure 2 exon(s)
Database links RefSeq NM_022049
Ensembl ENST00000315033
Entrez Gene Entrez Gene ID:54112
KEGG GENES KEGG GENES(54112)
GeneCard GeneCardGPR88*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000107631
Predicted CDS 438..1592;  384[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.764

Motif information
ORF

length(384),orf(438:1592)
MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANG
MVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPTGSAE
PPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQ
ALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGAAPPRIHYPALLAAAA
LLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAAAAAFPGA
QHAPGPGGAAHPAQAQPLPPALHPRRAQRRLSGLSVLLLCCVFLLATQPL
VWVSLASGFSLPVPWGVHAASWLLCCALSALNPLLYTWRNEEFRRSVRSV
LPGVGDAAAAAVAATAVPAVSQAQLGTRAAGQHW*
a.a.
length
InterPro Name
length(25), motif(33:57) 25 IPR000276 7TM GPCR, rhodopsin-like [Family]
length(289), motif(48:336) 289 IPR017452 GPCR, rhodopsin-like superfamily [Domain]
length(288), motif(49:336) 288 IPR000276 7TM GPCR, rhodopsin-like [Family]
length(22), motif(66:87) 22 IPR000276 7TM GPCR, rhodopsin-like [Family]
length(23), motif(120:142) 23 IPR000276 7TM GPCR, rhodopsin-like [Family]
length(27), motif(318:344) 27 IPR000276 7TM GPCR, rhodopsin-like [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000059328
H-Inv cluster ID Locus viewHIX0028498
Accession number AB042410.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition Similar to Uncharacterized protein;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (E1BHN7)  [Identity/coverage = 96.629%/100.0%] to Bos taurus (Bovine). protein.
Experimental evidence Protein evidence
PubMed ID 19390049ALL
Gene family/group Gene family H-Inv gene family/group ID HIF0000006
Gene family/group name Putative 7TM GPCR, rhodopsin-like (IPR000276).
Evidence motif (InterPro) ID IPR000276
Gene symbol/name HGNC symbol GPR88
HGNC aliases "G-protein coupled receptor 88", "G protein coupled receptor 88"
HGNC name G protein-coupled receptor 88
DDBJ strg
UniProt GPR88
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000107631
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NM_022049
Ensembl ENST00000315033
Entrez Gene Entrez Gene ID:54112
KEGG GENES KEGG GENES(54112)
GeneCard GeneCardGPR88*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Putative 7TM GPCR, rhodopsin-like (IPR000276). Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function rhodopsin-like receptor activity (GO:0001584); 
Biological process G-protein coupled receptor protein signaling pathway (GO:0007186); 
Cellular component integral to membrane (GO:0016021); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT plasma membrane; 
Target P signal peptide
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA260710;  AGhsB251102; 
Affymetrix
GeneChip
HG-Focus 220313_at; 
HG-U133 220313_at; 
HG-U133A 220313_at; 
HG-U133A_2 220313_at; 
HG-U133B NA
HG-U133_Plus_2 220313_at; 
HG-U95 51309_at; 
HG-U95A NA
HG-U95B 51309_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2348963;  2348964;  2348965;  2348966;  2348967;  2348968;  2348969;  2348970;  2348971;  2348972;  2348973;  2348974;  2348975;  2425342; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P149745; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P149749; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  115665116600155600600975605225605606606788606852606928607317607671608543608553608995610320612367612596
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(54112)
Disease Entrez Gene ID:(54112)
Substance Entrez Gene ID:(54112)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Evolutionary information  Evola Help Last modified:26-Mar-2013
Relationship Species Accession number MGI Links
Orthology Rattus sp. (Rat) AB042407 G-integraG-integra
Orthology Mus sp. (Mouse) AB042408 G-integraG-integra
Orthology Danio sp. (Zebrafish) ENSDART00000063313 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001107294 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_001135440 G-integraG-integra
Orthology Gallus sp. (Chicken) XM_001232658 G-integraG-integra
Orthology Bos sp. (Cow) XM_001249526 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001372133 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
68 .. 68 A/C rs2809823 - 5'UTR
177 .. 177 G/T rs61811413 + 5'UTR
316 .. 316 T/C rs2809822 - 5'UTR
330 .. 330 C/G rs6675102 + 5'UTR
341 .. 341 G/A rs116464679 + 5'UTR
448 .. 448 C/T rs75304635 + CDS Nonsynonymous[Ser4Phe]
514 .. 514 C/T rs76357122 + CDS Nonsynonymous[Ser26Leu]
545 .. 545 C/T rs79202630 + CDS Synonymous[Leu36Leu]
647 .. 647 T/C rs2809820 - CDS Synonymous[Ile70Ile]
704 .. 704 G/A rs80032519 + CDS Synonymous[Ala89Ala]
743 .. 743 C/G rs77713845 + CDS Synonymous[Pro102Pro]
755 .. 755 C/T rs74679959 + CDS Synonymous[Asp106Asp]
790 .. 790 G/A rs76802738 + CDS Nonsynonymous[Gly118Glu]
809 .. 809 C/T rs80129626 + CDS Synonymous[Leu124Leu]
851 .. 851 C/T rs78072575 + CDS Synonymous[Arg138Arg]
904 .. 904 G/T rs78459819 + CDS Nonsynonymous[Arg156Leu]
911 .. 911 G/A rs78962608 + CDS Synonymous[Thr158Thr]
913 .. 913 C/A rs76887342 + CDS Nonsynonymous[Ala159Glu]
923 .. 923 G/A rs75696192 + CDS Synonymous[Leu162Leu]
925 .. 925 C/T rs74772060 + CDS Nonsynonymous[Ala163Val]
934 .. 934 G/A rs79530516 + CDS AA-STOP[Trp166*]
937 .. 937 C/A rs77165825 + CDS Nonsynonymous[Ala167Glu]
944 .. 944 C/T rs75149309 + CDS Synonymous[Ala169Ala]
948 .. 948 G/A rs79510999 + CDS Nonsynonymous[Gly171Ser]
949 .. 949 G/A/T rs78966131 + CDS
957 .. 957 C/A rs74369583 + CDS Nonsynonymous[Leu174Met]
959 .. 959 G/A rs75068555 + CDS Synonymous[Leu174Leu]
960 .. 960 C/T rs76156421 + CDS Synonymous[Leu175Leu]
963 .. 963 C/T rs76223537 + CDS Nonsynonymous[Leu176Phe]
966 .. 966 C/T rs77456338 + CDS Nonsynonymous[Pro177Ser]
967 .. 967 C/T rs77557713 + CDS Nonsynonymous[Pro177Leu]
971 .. 971 C/T rs79809868 + CDS Synonymous[Pro178Pro]
973 .. 973 G/A rs78014578 + CDS AA-STOP[Trp179*]
975 .. 975 G/A rs74669629 + CDS Nonsynonymous[Ala180Thr]
983 .. 983 G/T rs76618759 + CDS Synonymous[Arg182Arg]
993 .. 993 G/A rs78914885 + CDS Nonsynonymous[Ala186Thr]
1001 .. 1001 G/A rs76465677 + CDS Synonymous[Pro188Pro]
1002 .. 1002 C/A/T rs78413351 + CDS
1003 .. 1003 G/T rs78064310 + CDS Nonsynonymous[Arg189Leu]
1005 .. 1005 A/G rs2809819 - CDS Nonsynonymous[Ile190Val]
1007 .. 1007 C/T rs75766095 + CDS Synonymous[Ile190Ile]
1008 .. 1008 C/T rs75858578 + CDS Nonsynonymous[His191Tyr]
1014 .. 1014 C/T rs74855924 + CDS Nonsynonymous[Pro193Ser]
1015 .. 1015 C/A rs75297640 + CDS Nonsynonymous[Pro193Gln]
1017 .. 1017 G/A rs75708003 + CDS Nonsynonymous[Ala194Thr]
1018 .. 1018 C/T rs80313629 + CDS Nonsynonymous[Ala194Val]
1282 .. 1282 G/T rs2518417 + CDS Nonsynonymous[Ser282Ile]
1377 .. 1377 C/- rs35060829 + CDS
1391 .. 1391 C/G rs3001995 + CDS Nonsynonymous[His318Gln]
1433 .. 1433 C/T rs3001996 + CDS Synonymous[Asn332Asn]
1770 .. 1770 C/T rs2809818 - 3'UTR
1799 .. 1799 C/T rs112754425 + 3'UTR
1817 .. 1817 C/T rs112165205 + 3'UTR
2066 ^ 2067 -/T rs34124285 + 3'UTR
2155 .. 2155 C/T rs41309189 + 3'UTR
2203 .. 2203 C/A rs116276992 + 3'UTR
2315 .. 2315 T/C rs113168342 + 3'UTR
2432 .. 2432 C/A rs41305878 + 3'UTR
2492 .. 2492 G/A rs2030048 + 3'UTR
2515 .. 2515 G/A rs6690417 + 3'UTR
2663 .. 2663 G/A rs2518418 + 3'UTR
2938 .. 2938 A/T rs114356145 + 3'UTR
2949 .. 2949 C/T rs2809817 - 3'UTR
2968 .. 2968 T/C rs2030049 + 3'UTR
3054 .. 3054 G/A rs2809816 - 3'UTR
3092 .. 3092 G/A rs116103635 + 3'UTR
3218 .. 3218 C/A rs78969967 + 3'UTR
3372 .. 3372 C/T rs4615860 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
Location Variation Strand
1157..1174 (cgc)6 +
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer