H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000059328 Accession number: AB042410 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Probable G-protein coupled receptor 88; Striatum-specific G-protein coupled receptor;
 
 

Transcript original information
Accession number AB042410.1
CAGE tag ID NA
EST ID NA
Clone Number NA
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (GPR88) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (GPR88);
Sequence data provider NA
Annotation project NA
Length of cDNA 3517[bp] (No. of exon:2)[A:807 T:888 G:849 C:973]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 3484(+) Signal: 3472-3476(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0028498
Genomic location  G-integra Help Chromosome 1
Location 1p21.2
Position 101003693- 101007571
Strand +
Possible duplicated location(s) NA
Gene structure 2 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:54112
KEGG GENES KEGG GENES(54112)
GeneCard GeneCardGPR88*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000107631
Predicted CDS 438..1592;  384[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.764

Motif information
ORF

length(384),orf(438:1592)
MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANG
MVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPTGSAE
PPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQ
ALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGAAPPRIHYPALLAAAA
LLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAAAAAFPGA
QHAPGPGGAAHPAQAQPLPPALHPRRAQRRLSGLSVLLLCCVFLLATQPL
VWVSLASGFSLPVPWGVHAASWLLCCALSALNPLLYTWRNEEFRRSVRSV
LPGVGDAAAAAVAATAVPAVSQAQLGTRAAGQHW*
a.a.
length
InterPro Name
length(192), motif(31:222) 192 IPR017452 GPCR, rhodopsin-like, 7TM [Domain]
length(25), motif(33:57) 25 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(289), motif(48:336) 289 IPR017452 GPCR, rhodopsin-like, 7TM [Domain]
length(288), motif(49:336) 288 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(22), motif(66:87) 22 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(23), motif(120:142) 23 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]
length(79), motif(274:352) 79 IPR017452 GPCR, rhodopsin-like, 7TM [Domain]
length(27), motif(318:344) 27 IPR000276 G protein-coupled receptor, rhodopsin-like [Family]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000059328
H-Inv cluster ID Locus viewHIX0028498
Accession number AB042410.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Protein coding; 
Definition Probable G-protein coupled receptor 88; Striatum-specific G-protein coupled receptor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q9GZN0)  [Identity/coverage = 99.479%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 110560491548933416710414ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol GPR88
HGNC aliases "G-protein coupled receptor 88", "G protein coupled receptor 88"
HGNC name G protein-coupled receptor 88
DDBJ strg
UniProt GPR88
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000107631
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:54112
KEGG GENES KEGG GENES(54112)
GeneCard GeneCardGPR88*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function G-protein coupled receptor activity (GO:0004930); 
Biological process G-protein coupled receptor protein signaling pathway (GO:0007186); 
Cellular component integral to membrane (GO:0016021); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT plasma membrane; 
Target P signal peptide
SOSUI membrane protein
TMHMM membrane protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA260710;  AGhsB251102; 
Affymetrix
GeneChip
HG-Focus 220313_at; 
HG-U133 220313_at; 
HG-U133A 220313_at; 
HG-U133A_2 220313_at; 
HG-U133B NA
HG-U133_Plus_2 220313_at; 
HG-U95 51309_at; 
HG-U95A NA
HG-U95B 51309_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2348963;  2348964;  2348965;  2348966;  2348967;  2348968;  2348969;  2348970;  2348971;  2348972;  2348973;  2348974;  2348975;  2425342; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P149745; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P149749; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Rattus sp. (Rat) AB042407 G-integraG-integra
Orthology Mus sp. (Mouse) AB042408 G-integraG-integra
Orthology Danio sp. (Zebrafish) ENSDART00000063313 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001107294 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_001135440 G-integraG-integra
Orthology Gallus sp. (Chicken) XM_001232658 G-integraG-integra
Orthology Bos sp. (Cow) XM_001249526 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001372133 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
66 .. 66 T/C rs189247274 + 5'UTR
68 .. 68 A/C rs2809823 - 5'UTR
96 .. 96 C/G rs181927197 + 5'UTR
177 .. 177 G/T rs61811413 + 5'UTR
316 .. 316 T/C rs2809822 - 5'UTR
330 .. 330 C/G rs6675102 + 5'UTR
341 .. 341 G/A rs116464679 + 5'UTR
351 .. 351 A/T rs187006639 + 5'UTR
448 .. 448 C/T rs75304635 + CDS Nonsynonymous[Ser4Phe]
491 .. 491 G/C rs140041648 + CDS Synonymous[Leu18Leu]
514 .. 514 C/T rs76357122 + CDS Nonsynonymous[Ser26Leu]
545 .. 545 C/T rs79202630 + CDS Synonymous[Leu36Leu]
574 .. 574 C/T rs138938028 + CDS Nonsynonymous[Thr46Met]
611 .. 611 C/G rs147094357 + CDS Synonymous[Ser58Ser]
647 .. 647 T/C rs2809820 - CDS Synonymous[Ile70Ile]
675 .. 675 G/A rs143920294 + CDS Nonsynonymous[Val80Ile]
704 .. 704 G/A rs80032519 + CDS Synonymous[Ala89Ala]
743 .. 743 C/G rs77713845 + CDS Synonymous[Pro102Pro]
755 .. 755 C/T rs74679959 + CDS Synonymous[Asp106Asp]
790 .. 790 G/A rs76802738 + CDS Nonsynonymous[Gly118Glu]
809 .. 809 C/T rs80129626 + CDS Synonymous[Leu124Leu]
822 .. 822 C/T rs148311288 + CDS Nonsynonymous[Leu129Phe]
851 .. 851 C/T rs78072575 + CDS Synonymous[Arg138Arg]
904 .. 904 G/T rs78459819 + CDS Nonsynonymous[Arg156Leu]
911 .. 911 G/A rs78962608 + CDS Synonymous[Thr158Thr]
913 .. 913 C/A rs76887342 + CDS Nonsynonymous[Ala159Glu]
923 .. 923 G/A rs75696192 + CDS Synonymous[Leu162Leu]
925 .. 925 C/T rs74772060 + CDS Nonsynonymous[Ala163Val]
934 .. 934 G/A rs79530516 + CDS AA-STOP[Trp166*]
937 .. 937 C/A rs77165825 + CDS Nonsynonymous[Ala167Glu]
944 .. 944 C/T rs75149309 + CDS Synonymous[Ala169Ala]
948 .. 948 G/A rs79510999 + CDS Nonsynonymous[Gly171Ser]
949 .. 949 G/A/T rs78966131 + CDS
957 .. 957 C/A rs74369583 + CDS Nonsynonymous[Leu174Met]
959 .. 959 G/A rs75068555 + CDS Synonymous[Leu174Leu]
960 .. 960 C/T rs76156421 + CDS Synonymous[Leu175Leu]
963 .. 963 C/T rs76223537 + CDS Nonsynonymous[Leu176Phe]
966 .. 966 C/T rs77456338 + CDS Nonsynonymous[Pro177Ser]
967 .. 967 C/T rs77557713 + CDS Nonsynonymous[Pro177Leu]
971 .. 971 C/T rs79809868 + CDS Synonymous[Pro178Pro]
973 .. 973 G/A rs78014578 + CDS AA-STOP[Trp179*]
975 .. 975 G/A rs74669629 + CDS Nonsynonymous[Ala180Thr]
983 .. 983 G/T rs76618759 + CDS Synonymous[Arg182Arg]
993 .. 993 G/A rs78914885 + CDS Nonsynonymous[Ala186Thr]
1001 .. 1001 G/A rs76465677 + CDS Synonymous[Pro188Pro]
1002 .. 1002 C/A/T rs78413351 + CDS
1003 .. 1003 G/T rs78064310 + CDS Nonsynonymous[Arg189Leu]
1005 .. 1005 A/G rs2809819 - CDS Nonsynonymous[Ile190Val]
1007 .. 1007 C/T rs75766095 + CDS Synonymous[Ile190Ile]
1008 .. 1008 C/T rs75858578 + CDS Nonsynonymous[His191Tyr]
1014 .. 1014 C/T rs74855924 + CDS Nonsynonymous[Pro193Ser]
1015 .. 1015 C/A rs75297640 + CDS Nonsynonymous[Pro193Gln]
1017 .. 1017 G/A rs75708003 + CDS Nonsynonymous[Ala194Thr]
1018 .. 1018 C/T rs80313629 + CDS Nonsynonymous[Ala194Val]
1090 .. 1090 G/T rs202171333 + CDS Nonsynonymous[Arg218Leu]
1282 .. 1282 G/T rs2518417 + CDS Nonsynonymous[Ser282Ile]
1340 .. 1340 G/A rs201200849 + CDS Synonymous[Val301Val]
1377 .. 1377 C/- rs35060829 + CDS
1391 .. 1391 C/G rs3001995 + CDS Nonsynonymous[His318Gln]
1433 .. 1433 C/T rs3001996 + CDS Synonymous[Asn332Asn]
1727 .. 1727 G/A rs182494985 + 3'UTR
1770 .. 1770 C/T rs2809818 - 3'UTR
1799 .. 1799 C/T rs112754425 + 3'UTR
1817 .. 1817 C/T rs112165205 + 3'UTR
2066 ^ 2067 -/T rs34124285 + 3'UTR
2155 .. 2155 C/T rs41309189 + 3'UTR
2203 .. 2203 C/A rs116276992 + 3'UTR
2268 .. 2268 G/A rs143252511 + 3'UTR
2315 .. 2315 T/C rs113168342 + 3'UTR
2363 .. 2363 A/C rs186232015 + 3'UTR
2432 .. 2432 C/A rs41305878 + 3'UTR
2492 .. 2492 G/A rs2030048 + 3'UTR
2515 .. 2515 G/A rs6690417 + 3'UTR
2564 .. 2564 T/C rs146706973 + 3'UTR
2573 .. 2573 A/G rs141347336 + 3'UTR
2579 .. 2579 A/G rs190079631 + 3'UTR
2611 .. 2611 T/C rs145109019 + 3'UTR
2663 .. 2663 G/A rs2518418 + 3'UTR
2673 .. 2673 A/T rs145844084 + 3'UTR
2938 .. 2938 A/T rs182701417 + 3'UTR
2949 .. 2949 C/T rs2809817 - 3'UTR
2957 .. 2957 A/G rs187028862 + 3'UTR
2968 .. 2968 T/C rs2030049 + 3'UTR
3051 .. 3051 G/A rs190343905 + 3'UTR
3054 .. 3054 G/A rs2809816 - 3'UTR
3092 .. 3092 G/A rs183731505 + 3'UTR
3264 .. 3264 C/G rs188661643 + 3'UTR
3372 .. 3372 C/T rs4615860 + 3'UTR
3387 .. 3387 C/A rs193280787 + 3'UTR
3392 .. 3392 T/A rs184260562 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer