H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000058537 Accession number: AB017919 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Protein-arginine deiminase type-4; EC=3.5.3.15; HL-60 PAD; Peptidylarginine deiminase IV; Protein-arginine deiminase type IV;
 
 

Motif information
ORF

length(663),orf(27:2018)
MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVV
DIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPK
TPPVKALLYLTAVEISLCADITRTGKVKPTRAVKDQRTWTWGPCGQGAIL
LVNCDRDNLESSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLV
LHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMVPGGKHNMDFY
VEALAFPDTDFPGLITLTISLLDTSNLELPEAVVFQDSVVFRVAPWIMTP
NTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQD
EMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGG
ISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDF
LSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLLLASPRSCYKL
FQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNR
ELLKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPK
PFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHIRHGEVHCGTNVR
RKPFSFKWWNMVP*
a.a.
length
InterPro Name
length(663), motif(1:663) 663 IPR016296 Protein-arginine deiminase, subgroup [Family]
length(111), motif(1:111) 111 IPR013732 Protein-arginine deiminase (PAD) N-terminal [Domain]
length(660), motif(2:661) 660 IPR004303 Protein-arginine deiminase [Family]
length(109), motif(4:112) 109 IPR008972 Cupredoxin [Domain]
length(181), motif(113:293) 181 IPR013733 Protein-arginine deiminase (PAD), central domain [Domain]
length(161), motif(113:273) 161 IPR013733 Protein-arginine deiminase (PAD), central domain [Domain]
length(386), motif(278:663) 386 IPR013530 Protein-arginine deiminase, C-terminal [Domain]