H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000051469 Accession number: BC035680 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: T-cell receptor alpha chain C region;
 
 

Motif information
ORF

length(275),orf(177:1004)
MASAPISMLAMLFTLSGLRAQSVAQPEDQVNVAEGNPLTVKCTYSVSGNP
YLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSA
LVSDSALYFCAVRDAKAAGNKLTFGGGTRVLVKPNIQNPDPAVYQLRDSK
SSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWS
NKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS
VIGFRILLLKVAGFNLLMTLRLWSS*
a.a.
length
InterPro Name
length(119), motif(5:123) 119 IPR007110 Immunoglobulin-like domain [Domain]
length(114), motif(21:134) 114 IPR013783 Immunoglobulin-like fold [Domain]
length(112), motif(21:132) 112 IPR013106 Immunoglobulin V-set domain [Domain]
length(89), motif(135:223) 89 IPR013783 Immunoglobulin-like fold [Domain]
length(84), motif(141:224) 84 IPR015370 Domain of unknown function DUF1968 [Domain]