H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000051469 Accession number: BC035680 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: T-cell receptor alpha chain C region;
 
 

Motif information
ORF

length(275),orf(177:1004)
MASAPISMLAMLFTLSGLRAQSVAQPEDQVNVAEGNPLTVKCTYSVSGNP
YLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSA
LVSDSALYFCAVRDAKAAGNKLTFGGGTRVLVKPNIQNPDPAVYQLRDSK
SSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWS
NKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLS
VIGFRILLLKVAGFNLLMTLRLWSS*
a.a.
length
InterPro Name
length(119), motif(5:123) 119 IPR007110 Immunoglobulin-like [Domain]
length(113), motif(21:133) 113 IPR013783 Immunoglobulin-like fold [Domain]
length(112), motif(21:132) 112 IPR013106 Immunoglobulin V-set [Domain]
length(107), motif(27:133) 107 IPR003599 Immunoglobulin subtype [Domain]
length(76), motif(37:112) 76 IPR003596 Immunoglobulin V-set, subgroup [Domain]
length(89), motif(135:223) 89 IPR013783 Immunoglobulin-like fold [Domain]
length(84), motif(141:224) 84 IPR015370 Domain of unknown function DUF1968 [Domain]