H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000040323 Accession number: BC027866 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase; EC=2.4.99.-; Alpha-2,8-sialyltransferase 8D; Polysialyltransferase-1; Sialyltransferase 8D; SIAT8-D; Sialytransferase St8Sia IV; ST8SiaIV;
 
 

Motif information
ORF

length(168),orf(260:766)
MRSIRKKWTICTISLLLIFYKTKEIARTEEHQETQLIGDGELSLSRSLVN
SSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKS
SFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGI
LLDSECGKEIDSHNFVIR*
a.a.
length
InterPro Name
length(77), motif(92:168) 77 IPR001675 Glycosyl transferase, family 29 [Family]