H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000038249 Accession number: BC018064 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Pseudogene candidate (Proteasome activator complex subunit 3; Activator of multicatalytic protease subunit 3; Proteasome activator 28 subunit gamma; PA28g; PA28gamma;)
 
 

Transcript original information
Accession number BC018064.1
CAGE tag ID NA
EST ID NA
Clone Number IMAGE:4816525
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ;
Sequence data provider Provider:MGC/NCI
Annotation project H-Invitational FLcDNA
Length of cDNA 1377[bp] (No. of exon:1)[A:373 T:352 G:337 C:315]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type Brain, hippocampus
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA Site: 1363(+) Signal: 1336-1340(+)
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0001254
Genomic location  G-integra Help Chromosome 1
Location 1q23.3
Position 161860623- 161861986
Strand +
Possible duplicated location(s) NA
Gene structure 1 exon(s)
Database links RefSeq NA
Ensembl ENST00000457671ENST00000458136
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS;  G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000026680
Predicted CDS 108..500;  130[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.796

Motif information
ORF

length(130),orf(108:500)
MAFLLKLEPDMQGKVDLFRARIAQEAEDLVSTFFPQKVLELNSRVQELRL
QDLSRIHSVPTSEPLATPGNKGDGPNQNLPVLLTQFSIKVPALLGSEGQL
LRSNQHLVELTEWVKPEIKLLREKCNTVHM*
a.a.
length
InterPro Name
length(129), motif(2:130) 129 IPR009077 Proteasome activator pa28, REG alpha/beta subunit [Family]
length(126), motif(5:130) 126 IPR009077 Proteasome activator pa28, REG alpha/beta subunit [Family]
length(54), motif(5:58) 54 IPR003185 Proteasome activator pa28, REG alpha subunit [Domain]
length(51), motif(8:58) 51 IPR003185 Proteasome activator pa28, REG alpha subunit [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000038249
H-Inv cluster ID Locus viewHIX0001254
Accession number BC018064.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript; 
Coding potential  Help Pseudogene candidates; 
Definition Pseudogene candidate (Proteasome activator complex subunit 3; Activator of multicatalytic protease subunit 3; Proteasome activator 28 subunit gamma; PA28g; PA28gamma;)
Similarity category  Help Category: Pseudogene candidate(Category VII).
Pseudogene candidate.
Experimental evidence NA
PubMed ID 1564209816287166ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol NA
HGNC aliases NA
HGNC name NA
DDBJ NA
UniProt PSME3
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID NA
No. of interaction NA
Interaction partner(s) NA
BIND NA
DIP NA
MINT NA
HPRD NA
IntAct NA
Database links RefSeq NA
Ensembl ENST00000457671ENST00000458136
Entrez Gene NA
KEGG GENES NA
GeneCard NA *GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function proteasome activator activity (GO:0008538); 
Cellular component proteasome activator complex (GO:0008537); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT cytosol;  nuclear;  mitochondria;  Other; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:26-Mar-2013
Start End PDB_ID E-value Identity Coverage SCOP_ID
5 130 1avo.1 4e-07 32.6 89/100 a.24.8.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene NA
Affymetrix
GeneChip
HG-Focus NA
HG-U133 243581_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 243581_at; 
HG-U133_Plus_2 243581_at; 
HG-U95 47683_at; 
HG-U95A NA
HG-U95B 47683_at; 
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2363994;  2363995;  2363996;  2363997;  2363998;  2363999;  2364000; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 NA
Whole Human Genome Oligo Microarray:PGID247 A_32_P461784; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  115665116600155600600975605225605606606788606852606928607317607671608543608553608995610320612367612596
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name NA
Disease NA
Substance NA
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Evolutionary information  Evola Help Last modified:26-Mar-2013
Relationship Species Accession number MGI Links
Orthology Monodelphis sp. (Opossum) XM_001362995 G-integraG-integra
Orthology Bos sp. (Cow) XM_598451 G-integraG-integra
Orthology Rattus sp. (Rat) XR_005705 G-integraG-integra
Orthology Mus sp. (Mouse) XR_032623 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
92 .. 92 G/C rs79004534 + 5'UTR
318 .. 318 A/G rs12032568 + CDS Nonsynonymous[Lys71Glu]
336 ^ 337 -/A rs34981911 + CDS
525 .. 525 G/C rs10753666 + 3'UTR
707 .. 707 G/A rs111541012 + 3'UTR
800 .. 800 T/C rs78671576 + 3'UTR
888 .. 888 A/C rs113726452 + 3'UTR
898 .. 898 G/T rs112597133 + 3'UTR
976 .. 976 A/T rs111323828 + 3'UTR
1084 .. 1084 A/T rs78056510 + 3'UTR
1277 .. 1277 G/A rs115336828 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer