H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000034397 Accession number: BC009483 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Interferon regulatory factor 1; IRF-1;
 
 

<?xml version="1.0" standalone="yes" ?>
<H-Inv>
  <cDNAXML>
    <CLUSTER-ID>HIX0005159</CLUSTER-ID>
    <CLUSTER-ID-VERSION>HIX0005159.19</CLUSTER-ID-VERSION>
    <H-INVITATIONAL-ID>HIT000034397</H-INVITATIONAL-ID>
    <H-INVITATIONAL-ID-VERSION>HIT000034397.19</H-INVITATIONAL-ID-VERSION>
    <ACCESSION-NO>BC009483</ACCESSION-NO>
    <ACCESSION-NO-VERSION>BC009483.2</ACCESSION-NO-VERSION>
    <GENOME-STATISTICS>build 37.1</GENOME-STATISTICS>
    <DIVISION>HUM</DIVISION>
    <MOL-TYPE>mRNA</MOL-TYPE>
    <CDNA_DATE-CREATE>26-Mar-2013</CDNA_DATE-CREATE>
    <CDNA_DATE-LAST-UPDATE>27-May-2015</CDNA_DATE-LAST-UPDATE>
    <CDNA_DATE-LAST-MODIFIED>27-May-2015</CDNA_DATE-LAST-MODIFIED>
    <CDNA_H-INV-DB-RELEASE>9.0</CDNA_H-INV-DB-RELEASE>
    <HIT-RELEASE>9.0</HIT-RELEASE>
    <CDNA_DATE-ANNOTATION-LAST-UPDATE>27-May-2015</CDNA_DATE-ANNOTATION-LAST-UPDATE>
    <CDNA_DATE-ANNOTATION-LAST-MODIFIED>27-May-2015</CDNA_DATE-ANNOTATION-LAST-MODIFIED>
    <HIT-ANNOTATION-RELEASE>9.0</HIT-ANNOTATION-RELEASE>
    <CHROMOSOME-NUMBER>5</CHROMOSOME-NUMBER>
    <CHROMOSOME-BAND>5q31.1</CHROMOSOME-BAND>
    <CDNA_START>131818780</CDNA_START>
    <CDNA_END>131826434</CDNA_END>
    <CDNA_STRAND>-</CDNA_STRAND>
    <CDNA_LOCUS_START>42649</CDNA_LOCUS_START>
    <CDNA_LOCUS_END>50303</CDNA_LOCUS_END>
    <CDNA_DB-REFERENCE_KEGG-GENES>3659</CDNA_DB-REFERENCE_KEGG-GENES>
    <CDNA_DB-REFERENCE_ENTREZGENE>3659</CDNA_DB-REFERENCE_ENTREZGENE>
    <CDNA_DB-REFERENCE_CCDS>CCDS4155</CDNA_DB-REFERENCE_CCDS>
    <CDNA_REP-H-INVITATIONAL>Representative transcript</CDNA_REP-H-INVITATIONAL>
    <CDNA_PROTEIN_REP_H-INVITATIONAL>Representative transcript</CDNA_PROTEIN_REP_H-INVITATIONAL>
    <CDNA_SPLICING-ISOFORM_CURATION>Splicing isoform</CDNA_SPLICING-ISOFORM_CURATION>
    <CDNA_SPLICE-ACCEPTOR>CAGGAG</CDNA_SPLICE-ACCEPTOR>
    <CDNA_H-INVITATIONAL-PROTEIN-ID>HIP000084307</CDNA_H-INVITATIONAL-PROTEIN-ID>
    <CDNA_H-INVITATIONAL-PROTEIN-ID-VERSION>HIP000084307.1</CDNA_H-INVITATIONAL-PROTEIN-ID-VERSION>
    <CDNA_NO_OF_INTERACTION>12</CDNA_NO_OF_INTERACTION>
    <CDNA_INTERACTION-PARTNER>HIP000026951</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000027985</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000069516</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000085289</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000095247</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000096767</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000106166</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000106166</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000106180</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000136362</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000148140</CDNA_INTERACTION-PARTNER>
    <CDNA_INTERACTION-PARTNER>HIP000148140</CDNA_INTERACTION-PARTNER>
    <CDNA_DB-REFERENCE_REFSEQ-PROTEIN-ID>NP_002189</CDNA_DB-REFERENCE_REFSEQ-PROTEIN-ID>
    <CDNA_DB-REFERENCE_UNIPROT-PROTEIN-ID>P10914</CDNA_DB-REFERENCE_UNIPROT-PROTEIN-ID>
    <CDNA_DB-REFERENCE_DIP-ID>115228E</CDNA_DB-REFERENCE_DIP-ID>
    <CDNA_DB-REFERENCE_DIP-ID>88067E</CDNA_DB-REFERENCE_DIP-ID>
    <CDNA_DB-REFERENCE_DIP-ID>88068E</CDNA_DB-REFERENCE_DIP-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>01238</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>01241</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>02777</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>02829</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>02867</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>03336</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>03554</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>04078</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>06780</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>07223</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>08931</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_HPRD-ID>10556</CDNA_DB-REFERENCE_HPRD-ID>
    <CDNA_DB-REFERENCE_PUBMED>1382447</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>2726461</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>3409321</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>8438156</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>9679752</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>10094406</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>10395927</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>11244049</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>11846971</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>11846974</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>15226432</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>15489334</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>15509808</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>16932750</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>17516545</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>17942705</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>18084608</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>18497060</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>18641303</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>19404407</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>19851330</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>20049431</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>21389130</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>22200613</CDNA_DB-REFERENCE_PUBMED>
    <CDNA_DB-REFERENCE_PUBMED>22367195</CDNA_DB-REFERENCE_PUBMED>
    <JOURNAL_DB-REFERENCE_MEDLINE>15103394</JOURNAL_DB-REFERENCE_MEDLINE>
    <MRNA-INSPECTION>
      <CLONE-NUMBER_ORIGINAL>MGC:15355 IMAGE:3623414</CLONE-NUMBER_ORIGINAL>
      <TISSUE-TYPE-ORIGIN_ORIGINAL>Pancreas, adenocarcinoma</TISSUE-TYPE-ORIGIN_ORIGINAL>
      <DATA-PROVIDER>MGC/NCI</DATA-PROVIDER>
      <LENGTH-OF-CDNA_ORIGINAL>2061</LENGTH-OF-CDNA_ORIGINAL>
      <NUMBER-OF-EXON_ORIGINAL>10</NUMBER-OF-EXON_ORIGINAL>
      <NUMBER-OF-A_ORIGINAL>497</NUMBER-OF-A_ORIGINAL>
      <NUMBER-OF-T_ORIGINAL>425</NUMBER-OF-T_ORIGINAL>
      <NUMBER-OF-G_ORIGINAL>556</NUMBER-OF-G_ORIGINAL>
      <NUMBER-OF-C_ORIGINAL>583</NUMBER-OF-C_ORIGINAL>
    </MRNA-INSPECTION>
    <PATHOLOGY>
      <PATHOLOGY_DATE-LAST-UPDATE>27-May-2015</PATHOLOGY_DATE-LAST-UPDATE>
      <PATHOLOGY_DATE-LAST-MODIFIED>27-May-2015</PATHOLOGY_DATE-LAST-MODIFIED>
      <PATHOLOGY_DISEASE-RELEASE>9.0</PATHOLOGY_DISEASE-RELEASE>
      <KNOWN-DISEASE-GENE>
        <CDNA-OMIM_DB-REFERENCE_OMIM-DISEASE>137215</CDNA-OMIM_DB-REFERENCE_OMIM-DISEASE>
        <CDNA-OMIM_DISEASE_DISEASE-NAME>Gastric cancer</CDNA-OMIM_DISEASE_DISEASE-NAME>
        <CDNA-OMIM_DB-REFERENCE_OMIM-DISEASE>153550</CDNA-OMIM_DB-REFERENCE_OMIM-DISEASE>
        <CDNA-OMIM_DISEASE_DISEASE-NAME>Macrocytic anemia, refractory, of 5q- syndrome</CDNA-OMIM_DISEASE_DISEASE-NAME>
        <CDNA-OMIM_DISEASE-RELATION>Myelodysplastic syndrome, preleukemic</CDNA-OMIM_DISEASE-RELATION>
        <CDNA-OMIM_DISEASE-RELATION>Myelogenous leukemia, acute</CDNA-OMIM_DISEASE-RELATION>
        <CDNA-OMIM_DISEASE-RELATION>Nonsmall cell lung cancer</CDNA-OMIM_DISEASE-RELATION>
        <CDNA-OMIM_DB-REFERENCE_OMIM>147575</CDNA-OMIM_DB-REFERENCE_OMIM>
        <CDNA-OMIM_MORBID-MAP_OMIM-TITLE>INTERFERON REGULATORY FACTOR 1</CDNA-OMIM_MORBID-MAP_OMIM-TITLE>
      </KNOWN-DISEASE-GENE>
    </PATHOLOGY>
    <EVOLUTIONARY-FEATURE>
      <EVOLUTIONARY-FEATURE_DATE-LAST-UPDATE>27-May-2015</EVOLUTIONARY-FEATURE_DATE-LAST-UPDATE>
      <EVOLUTIONARY-FEATURE_DATE-LAST-MODIFIED>27-May-2015</EVOLUTIONARY-FEATURE_DATE-LAST-MODIFIED>
      <EVOLUTIONARY-FEATURE_EVOLUTION-RELEASE>9.0</EVOLUTIONARY-FEATURE_EVOLUTION-RELEASE>
      <ORTHOLOGY>
        <ACCESSION-NO>AK157347</ACCESSION-NO>
        <SPECIES>Mus sp. (Mouse)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>BC102766</ACCESSION-NO>
        <SPECIES>Bos sp. (Cow)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>ENSGALT00000002244</ACCESSION-NO>
        <SPECIES>Gallus sp. (Chicken)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>ENSMMUT00000011322</ACCESSION-NO>
        <SPECIES>Macaca sp. (Macaque)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>ENSPPYT00000018338</ACCESSION-NO>
        <SPECIES>Pongo sp. (Orangutan)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>ENSPTRT00000031881</ACCESSION-NO>
        <SPECIES>Pan sp. (Chimpanzee)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>GSTENT00037577001</ACCESSION-NO>
        <SPECIES>Tetraodon sp. (Tetraodon)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>M34253</ACCESSION-NO>
        <SPECIES>Rattus sp. (Rat)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>SINFRUT00000130702</ACCESSION-NO>
        <SPECIES>Takifugu sp. (Fugu)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>XM_001371779</ACCESSION-NO>
        <SPECIES>Monodelphis sp. (Opossum)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>XM_001504445</ACCESSION-NO>
        <SPECIES>Equus sp. (Horse)</SPECIES>
      </ORTHOLOGY>
      <ORTHOLOGY>
        <ACCESSION-NO>XM_538621</ACCESSION-NO>
        <SPECIES>Canis sp. (Dog)</SPECIES>
      </ORTHOLOGY>
    </EVOLUTIONARY-FEATURE>
    <CDNA-INFO>
      <SNP>
        <SNP_START>22</SNP_START>
        <SNP_END>22</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs11242115</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/C</SNP_BASE-CDNA>
        <SNP_LOCATION>5'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>113</SNP_START>
        <SNP_END>113</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs10900809</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>T/C</SNP_BASE-CDNA>
        <SNP_LOCATION>5'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>125</SNP_START>
        <SNP_END>125</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs960757</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>5'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>128</SNP_START>
        <SNP_END>128</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs111285485</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>5'UTR</SNP_LOCATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>172</SNP_START>
        <SNP_END>172</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs17848393</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/A</SNP_BASE-CDNA>
        <SNP_LOCATION>5'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>225</SNP_START>
        <SNP_END>225</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs121912469</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>A/T</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Nonsynonymous[Met8Leu]</SNP_TRANSLATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>233</SNP_START>
        <SNP_END>233</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs201470560</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/G</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Pro10Pro]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>234</SNP_START>
        <SNP_END>234</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs121912470</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>T/C</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Nonsynonymous[Trp11Arg]</SNP_TRANSLATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>259</SNP_START>
        <SNP_END>259</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs200434461</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>A/G</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Nonsynonymous[Asn19Ser]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>305</SNP_START>
        <SNP_END>305</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs117282832</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Phe34Phe]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>402</SNP_START>
        <SNP_END>402</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs137993322</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/C</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Nonsynonymous[Ala67Pro]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>476</SNP_START>
        <SNP_END>476</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs199589588</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Ile91Ile]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>522</SNP_START>
        <SNP_END>522</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs146963938</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>AA-STOP[Arg107*]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>527</SNP_START>
        <SNP_END>527</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs149276593</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/A</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Val108Val]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>548</SNP_START>
        <SNP_END>548</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs17622685</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/G</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Leu115Leu]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>605</SNP_START>
        <SNP_END>605</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs200378665</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/A</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Lys134Lys]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>656</SNP_START>
        <SNP_END>656</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs185307675</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>A/T</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Gly151Gly]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>695</SNP_START>
        <SNP_END>695</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs138606864</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Tyr164Tyr]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>710</SNP_START>
        <SNP_END>710</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs201815197</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Tyr169Tyr]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>727</SNP_START>
        <SNP_END>727</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs150089120</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>T/C</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Nonsynonymous[Val175Ala]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>758</SNP_START>
        <SNP_END>758</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs9282762</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>A/G</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Pro185Pro]</SNP_TRANSLATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>782</SNP_START>
        <SNP_END>782</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs17848410</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Pro193Pro]</SNP_TRANSLATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>811</SNP_START>
        <SNP_END>811</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs146891501</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Nonsynonymous[Pro203Leu]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>862</SNP_START>
        <SNP_END>862</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs145101897</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Nonsynonymous[Thr220Ile]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>875</SNP_START>
        <SNP_END>875</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs141364775</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>A/C</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Thr224Thr]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>935</SNP_START>
        <SNP_END>935</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs201186445</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/A</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Ser244Ser]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>954</SNP_START>
        <SNP_END>954</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs201857248</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/A</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Nonsynonymous[Val251Met]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>968</SNP_START>
        <SNP_END>968</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs199626190</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/A</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Gly255Gly]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>979</SNP_START>
        <SNP_END>979</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs200736826</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>A/G</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Nonsynonymous[Asn259Ser]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1019</SNP_START>
        <SNP_END>1019</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs146613421</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>T/C</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Phe272Phe]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1055</SNP_START>
        <SNP_END>1055</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs113976540</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/C</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Gly284Gly]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1133</SNP_START>
        <SNP_END>1133</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs142853835</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/A</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Leu310Leu]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1146</SNP_START>
        <SNP_END>1146</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs55746618</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>T/C</SNP_BASE-CDNA>
        <SNP_LOCATION>CDS</SNP_LOCATION>
        <SNP_TRANSLATION>Synonymous[Leu315Leu]</SNP_TRANSLATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1218</SNP_START>
        <SNP_END>1218</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs56288038</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/G</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1323</SNP_START>
        <SNP_END>1323</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs17848427</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1332</SNP_START>
        <SNP_END>1332</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs190321767</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>T/C</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1562</SNP_START>
        <SNP_END>1562</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs17848428</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1609</SNP_START>
        <SNP_END>1609</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs34850771</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/A</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1625</SNP_START>
        <SNP_END>1625</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs17848429</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/A/T</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1627</SNP_START>
        <SNP_END>1627</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs35642338</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/G</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1690</SNP_START>
        <SNP_END>1690</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs17848431</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>T/C</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1693</SNP_START>
        <SNP_END>1693</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs35178118</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/A</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1698</SNP_START>
        <SNP_END>1698</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs839</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/A</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1834</SNP_START>
        <SNP_END>1834</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs17848433</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/A</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1876</SNP_START>
        <SNP_END>1876</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs17848434</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>C/T</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>+</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>1922</SNP_START>
        <SNP_END>1922</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs145347120</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/C</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>2009</SNP_START>
        <SNP_END>2009</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs115945411</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>A/G</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <SNP>
        <SNP_START>2019</SNP_START>
        <SNP_END>2019</SNP_END>
        <SNP_LOCATION-TYPE>..</SNP_LOCATION-TYPE>
        <SNP_DB-REFERENCE_DBSNP>rs139911206</SNP_DB-REFERENCE_DBSNP>
        <SNP_BASE-CDNA>G/T</SNP_BASE-CDNA>
        <SNP_LOCATION>3'UTR</SNP_LOCATION>
        <SNP_STRAND>-</SNP_STRAND>
      </SNP>
      <POLYA>
        <POLYA_SITE>2044</POLYA_SITE>
        <POLYA_STRAND>+</POLYA_STRAND>
      </POLYA>
      <EXON-CDNA>
        <EXON-CDNA_START>1</EXON-CDNA_START>
        <EXON-CDNA_END>198</EXON-CDNA_END>
      </EXON-CDNA>
      <EXON-CDNA>
        <EXON-CDNA_START>199</EXON-CDNA_START>
        <EXON-CDNA_END>290</EXON-CDNA_END>
      </EXON-CDNA>
      <EXON-CDNA>
        <EXON-CDNA_START>291</EXON-CDNA_START>
        <EXON-CDNA_END>390</EXON-CDNA_END>
      </EXON-CDNA>
      <EXON-CDNA>
        <EXON-CDNA_START>391</EXON-CDNA_START>
        <EXON-CDNA_END>567</EXON-CDNA_END>
      </EXON-CDNA>
      <EXON-CDNA>
        <EXON-CDNA_START>568</EXON-CDNA_START>
        <EXON-CDNA_END>617</EXON-CDNA_END>
      </EXON-CDNA>
      <EXON-CDNA>
        <EXON-CDNA_START>618</EXON-CDNA_START>
        <EXON-CDNA_END>747</EXON-CDNA_END>
      </EXON-CDNA>
      <EXON-CDNA>
        <EXON-CDNA_START>748</EXON-CDNA_START>
        <EXON-CDNA_END>870</EXON-CDNA_END>
      </EXON-CDNA>
      <EXON-CDNA>
        <EXON-CDNA_START>871</EXON-CDNA_START>
        <EXON-CDNA_END>920</EXON-CDNA_END>
      </EXON-CDNA>
      <EXON-CDNA>
        <EXON-CDNA_START>921</EXON-CDNA_START>
        <EXON-CDNA_END>1056</EXON-CDNA_END>
      </EXON-CDNA>
      <EXON-CDNA>
        <EXON-CDNA_START>1057</EXON-CDNA_START>
        <EXON-CDNA_END>2061</EXON-CDNA_END>
      </EXON-CDNA>
      <EXON-GENOME>
        <EXON-GENOME_START>131826237</EXON-GENOME_START>
        <EXON-GENOME_END>131826434</EXON-GENOME_END>
      </EXON-GENOME>
      <EXON-GENOME>
        <EXON-GENOME_START>131825084</EXON-GENOME_START>
        <EXON-GENOME_END>131825175</EXON-GENOME_END>
      </EXON-GENOME>
      <EXON-GENOME>
        <EXON-GENOME_START>131823618</EXON-GENOME_START>
        <EXON-GENOME_END>131823717</EXON-GENOME_END>
      </EXON-GENOME>
      <EXON-GENOME>
        <EXON-GENOME_START>131822646</EXON-GENOME_START>
        <EXON-GENOME_END>131822822</EXON-GENOME_END>
      </EXON-GENOME>
      <EXON-GENOME>
        <EXON-GENOME_START>131822487</EXON-GENOME_START>
        <EXON-GENOME_END>131822536</EXON-GENOME_END>
      </EXON-GENOME>
      <EXON-GENOME>
        <EXON-GENOME_START>131822249</EXON-GENOME_START>
        <EXON-GENOME_END>131822378</EXON-GENOME_END>
      </EXON-GENOME>
      <EXON-GENOME>
        <EXON-GENOME_START>131821943</EXON-GENOME_START>
        <EXON-GENOME_END>131822065</EXON-GENOME_END>
      </EXON-GENOME>
      <EXON-GENOME>
        <EXON-GENOME_START>131821359</EXON-GENOME_START>
        <EXON-GENOME_END>131821408</EXON-GENOME_END>
      </EXON-GENOME>
      <EXON-GENOME>
        <EXON-GENOME_START>131820054</EXON-GENOME_START>
        <EXON-GENOME_END>131820189</EXON-GENOME_END>
      </EXON-GENOME>
      <EXON-GENOME>
        <EXON-GENOME_START>131818762</EXON-GENOME_START>
        <EXON-GENOME_END>131819767</EXON-GENOME_END>
      </EXON-GENOME>
      <CDS-GENOME-START>131819643</CDS-GENOME-START>
      <CDS-GENOME-END>131825170</CDS-GENOME-END>
    </CDNA-INFO>
    <SEQUENCE>
      <NUCLEOTIDE_ORIGINAL>GTGCGCCCGAGCCCCGCCGAAGCGAGGCCACCCGGAGCCGTGCCCAGTCCACGCCGGCCGTGCCCGGCGGCCTTAAGAACCCGGCAACCTCTGCCTTCTTCCCTCTTCCACTTGGAGTCGCGCTCCGCGCGCCCTCACTGCAGCCCCTGCGTCGCCGGGACCCTCGCGCGCGACCGCCGAATCGCTCCTGCAGCAGAGCCAACATGCCCATCACTCGGATGCGCATGAGACCCTGGCTAGAGATGCAGATTAATTCCAACCAAATCCCGGGGCTCATCTGGATTAATAAAGAGGAGATGATCTTCCAGATCCCATGGAAGCATGCTGCCAAGCATGGCTGGGACATCAACAAGGATGCCTGTTTGTTCCGGAGCTGGGCCATTCACACAGGCCGATACAAAGCAGGGGAAAAGGAGCCAGATCCCAAGACGTGGAAGGCCAACTTTCGCTGTGCCATGAACTCCCTGCCAGATATCGAGGAGGTGAAAGACCAGAGCAGGAACAAGGGCAGCTCAGCTGTGCGAGTGTACCGGATGCTTCCACCTCTCACCAAGAACCAGAGAAAAGAAAGAAAGTCGAAGTCCAGCCGAGATGCTAAGAGCAAGGCCAAGAGGAAGTCATGTGGGGATTCCAGCCCTGATACCTTCTCTGATGGACTCAGCAGCTCCACTCTGCCTGATGACCACAGCAGCTACACAGTTCCAGGCTACATGCAGGACTTGGAGGTGGAGCAGGCCCTGACTCCAGCACTGTCGCCATGTGCTGTCAGCAGCACTCTCCCCGACTGGCACATCCCAGTGGAAGTTGTGCCGGACAGCACCAGTGATCTGTACAACTTCCAGGTGTCACCCATGCCCTCCACCTCTGAAGCTACAACAGATGAGGATGAGGAAGGGAAATTACCTGAGGACATCATGAAGCTCTTGGAGCAGTCGGAGTGGCAGCCAACAAACGTGGATGGGAAGGGGTACCTACTCAATGAACCTGGAGTCCAGCCCACCTCTGTCTATGGAGACTTTAGCTGTAAGGAGGAGCCAGAAATTGACAGCCCAGGGGGGGATATTGGGCTGAGTCTACAGCGTGTCTTCACAGATCTGAAGAACATGGATGCCACCTGGCTGGACAGCCTGCTGACCCCAGTCCGGTTGCCCTCCATCCAGGCCATTCCCTGTGCACCGTAGCAGGGCCCCTGGGCCCCTCTTATTCCTCTAGGCAAGCAGGACCTGGCATCATGGTGGATATGGTGCAGAGAAGCTGGACTTCTGTGGGCCCCTCAACAGCCAAGTGTGACCCCACTGCCAAGTGGGGATGGGGCCTCCCTCCTTGGGTCATTGACCTCTCAGGGCCTGGCAGGCCAGTGTCTGGGTTTTTCTTGTGGTGTAAAGCTGGCCCTGCCTCCTGGGAAGATGAGGTTCTGAGACCAGTGTATCAGGTCAGGGACTTGGACAGGAGTCAGTGTCTGGCTTTTTCCTCTGAGCCCAGCTGCCTGGAGAGGGTCTCGCTGTCACTGGCTGGCTCCTAGGGGAACAGACCAGTGACCCCAGAAAAGCATAACACCAATCCCAGGGCTGGCTCTGCACTAAGAGAAAATTGCACTAAATGAATCTCGTTCCCAAAGAACTACCCCCTTTTCAGCTGAGCCCTGGGGACTGTTCCAAAGCCAGTGAAATGTGAAGGAAAGTGGGGTCCTTCGGGGCGATGCTCCCTCAGCCTCAGAGGAGCTCTACCCTGCTCCCTGCTTTGGCTGAGGGGCTTGGGAAAAAAACTTGGCACTTTTTCGTGTGGATCTTGCCACATTTCTGATCAGAGGTGTACACTAACATTTCCCCCGAGCTCTTGGCCTTTGCATTTATTTATACAGTGCCTTGCTCGGCGCCCACCACCCCCTCAAGCCCCAGCAGCCCTCAACAGGCCCAGGGAGGGAAGTGTGAGCGCCTTGGTATGACTTAAAATTGGAAATGTCATCTAACCATTAAGTCATGTGTGAACACATAGGACGTGTGTAAATATGTACATTTGTCTTTTTATAAAAAGTAAATTGTTAAAAAAAAAAAAAAAAAA</NUCLEOTIDE_ORIGINAL>
    </SEQUENCE>
    <PREDICTED-ORF>
      <CODING-POTENTIAL>Protein coding</CODING-POTENTIAL>
      <CDS_SOURCE_START>1</CDS_SOURCE_START>
      <CDS_SOURCE_END>2061</CDS_SOURCE_END>
      <CDS_START>204</CDS_START>
      <CDS_END>1181</CDS_END>
      <LENGTH-OF-CDS>325</LENGTH-OF-CDS>
      <ORIENTATION>forward</ORIENTATION>
      <FRAME>+3</FRAME>
      <FEATURE>Complete CDS</FEATURE>
      <CAI>0.823</CAI>
    </PREDICTED-ORF>
    <FUNCTION>
      <DEFINITION>
        <DATA-SOURCE_DB-REFERENCE_PROTEIN-MOTIF-ID>P10914</DATA-SOURCE_DB-REFERENCE_PROTEIN-MOTIF-ID>
        <DATA-SOURCE_IDENTITY>100.0</DATA-SOURCE_IDENTITY>
        <DATA-SOURCE_COVERAGE>100.0</DATA-SOURCE_COVERAGE>
        <DATA-SOURCE_HOMOLOGOUS_SPECIES>Homo sapiens (Human).</DATA-SOURCE_HOMOLOGOUS_SPECIES>
        <DATA-SOURCE_CURATION-STATUS>Human curated</DATA-SOURCE_CURATION-STATUS>
        <DATA-SOURCE_DEFINITION>Interferon regulatory factor 1; IRF-1;</DATA-SOURCE_DEFINITION>
        <DATA-SOURCE_SIMILARITY-CATEGORY>Identical to known human protein(Category I).</DATA-SOURCE_SIMILARITY-CATEGORY>
        <EXP-EVIDENCE>Protein evidence</EXP-EVIDENCE>
        <EXP-CODE>1</EXP-CODE>
        <GENENAME-SYMBOL_DDBJ-EMBL-GenBank>IRF1</GENENAME-SYMBOL_DDBJ-EMBL-GenBank>
        <GENENAME-SYMBOL_PROTEIN_SWISS-PROT>IRF1</GENENAME-SYMBOL_PROTEIN_SWISS-PROT>
        <HGNC>
          <HUGO-APPROVED-GENE-SYMBOL_GENEW>IRF1</HUGO-APPROVED-GENE-SYMBOL_GENEW>
          <APPROVED-NAME_GENEW>interferon regulatory factor 1</APPROVED-NAME_GENEW>
        </HGNC>
      </DEFINITION>
      <GENE-ONTOLOGY>
        <DOMAIN_DB-REFERENCE_INTERPRO>IPR001346</DOMAIN_DB-REFERENCE_INTERPRO>
        <DOMAIN_NAME>Interferon regulatory factor DNA-binding domain</DOMAIN_NAME>
        <DOMAIN_TYPE>Domain</DOMAIN_TYPE>
        <DOMAIN>
          <DOMAIN_MOTIF_START>204</DOMAIN_MOTIF_START>
          <DOMAIN_MOTIF_END>545</DOMAIN_MOTIF_END>
          <DOMAIN_MOTIF_START>216</DOMAIN_MOTIF_START>
          <DOMAIN_MOTIF_END>542</DOMAIN_MOTIF_END>
          <DOMAIN_MOTIF_START>222</DOMAIN_MOTIF_START>
          <DOMAIN_MOTIF_END>281</DOMAIN_MOTIF_END>
          <DOMAIN_MOTIF_START>300</DOMAIN_MOTIF_START>
          <DOMAIN_MOTIF_END>341</DOMAIN_MOTIF_END>
          <DOMAIN_MOTIF_START>354</DOMAIN_MOTIF_START>
          <DOMAIN_MOTIF_END>407</DOMAIN_MOTIF_END>
          <DOMAIN_MOTIF_START>423</DOMAIN_MOTIF_START>
          <DOMAIN_MOTIF_END>491</DOMAIN_MOTIF_END>
        </DOMAIN>
        <DOMAIN_DB-REFERENCE_INTERPRO>IPR011991</DOMAIN_DB-REFERENCE_INTERPRO>
        <DOMAIN_NAME>Winged helix-turn-helix DNA-binding domain</DOMAIN_NAME>
        <DOMAIN_TYPE>Domain</DOMAIN_TYPE>
        <DOMAIN>
          <DOMAIN_MOTIF_START>204</DOMAIN_MOTIF_START>
          <DOMAIN_MOTIF_END>542</DOMAIN_MOTIF_END>
        </DOMAIN>
        <DOMAIN_DB-REFERENCE_INTERPRO>IPR019817</DOMAIN_DB-REFERENCE_INTERPRO>
        <DOMAIN_NAME>Interferon regulatory factor, conserved site</DOMAIN_NAME>
        <DOMAIN_TYPE>Conserved_site</DOMAIN_TYPE>
        <DOMAIN>
          <DOMAIN_MOTIF_START>279</DOMAIN_MOTIF_START>
          <DOMAIN_MOTIF_END>380</DOMAIN_MOTIF_END>
          <DOMAIN_MOTIF>
            <GO_ORGANIZING-PRINCIPLE>Molecular function</GO_ORGANIZING-PRINCIPLE>
            <GO_DB-REFERENCE_GO>0003700</GO_DB-REFERENCE_GO>
            <GO_TERM>transcription factor activity</GO_TERM>
          </DOMAIN_MOTIF>
          <DOMAIN_MOTIF>
            <GO_ORGANIZING-PRINCIPLE>Biological process</GO_ORGANIZING-PRINCIPLE>
            <GO_DB-REFERENCE_GO>0006355</GO_DB-REFERENCE_GO>
            <GO_TERM>regulation of transcription, DNA-dependent</GO_TERM>
          </DOMAIN_MOTIF>
        </DOMAIN>
      </GENE-ONTOLOGY>
      <CELLULAR-LOCATION>
        <CELLULAR-LOCATION_DATE-LAST-UPDATE>27-May-2015</CELLULAR-LOCATION_DATE-LAST-UPDATE>
        <CELLULAR-LOCATION_DATE-LAST-MODIFIED>27-May-2015</CELLULAR-LOCATION_DATE-LAST-MODIFIED>
        <CELLULAR-LOCATION_SUBCELLULAR-RELEASE>9.0</CELLULAR-LOCATION_SUBCELLULAR-RELEASE>
        <LOCATION_WPSORT>nuclear</LOCATION_WPSORT>
        <TARGET-P>Not predicted</TARGET-P>
        <SOSUI>soluble protein</SOSUI>
        <TMHMM>soluble protein</TMHMM>
        <PTS1>
          <CSEQ>RLPSIQAIPCAP</CSEQ>
          <SCORE>-29.964</SCORE>
          <LOCATION>Not targeted</LOCATION>
        </PTS1>
      </CELLULAR-LOCATION>
    </FUNCTION>
    <PROTEIN-STRUCTURE>
      <PROTEIN-STRUCTURE_DATE-LAST-UPDATE>27-May-2015</PROTEIN-STRUCTURE_DATE-LAST-UPDATE>
      <PROTEIN-STRUCTURE_DATE-LAST-MODIFIED>27-May-2015</PROTEIN-STRUCTURE_DATE-LAST-MODIFIED>
      <PROTEIN-STRUCTURE_3D-STRUCTURE-RELEASE>9.0</PROTEIN-STRUCTURE_3D-STRUCTURE-RELEASE>
      <SECONDARY-TERTIARY-STRUCTURE>
        <STRUCTURE_START>7</STRUCTURE_START>
        <STRUCTURE_END>111</STRUCTURE_END>
        <STRUCTURE_DB-REFERENCE_PDB>1if1A</STRUCTURE_DB-REFERENCE_PDB>
        <STRUCTURE_EVALUE>9e-47</STRUCTURE_EVALUE>
        <STRUCTURE_IDENTITY>100.0</STRUCTURE_IDENTITY>
        <STRUCTURE_COVERAGE>105/105</STRUCTURE_COVERAGE>
        <STRUCTURE_DOMAIN_DB-REFERENCE_SCOP>a.4.5.23</STRUCTURE_DOMAIN_DB-REFERENCE_SCOP>
        <STRUCTURE_DOMAIN_ANOMALOUS-STRUCTURE>YES</STRUCTURE_DOMAIN_ANOMALOUS-STRUCTURE>
      </SECONDARY-TERTIARY-STRUCTURE>
    </PROTEIN-STRUCTURE>
    <SEQUENCE_TRANSLATION>MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP*</SEQUENCE_TRANSLATION>
    <EXPRESSION>
      <EXPRESSION_DATE-LAST-UPDATE>27-May-2015</EXPRESSION_DATE-LAST-UPDATE>
      <EXPRESSION_DATE-LAST-MODIFIED>27-May-2015</EXPRESSION_DATE-LAST-MODIFIED>
      <PROBE-MAPPING>
        <PLATFORM>
          <PLATFORM-TYPE>AceGene</PLATFORM-TYPE>
          <PROBE>
            <PROBE-TYPE>AceGene</PROBE-TYPE>
            <PROBE-ID>AGhsA220418</PROBE-ID>
          </PROBE>
        </PLATFORM>
        <PLATFORM>
          <PLATFORM-TYPE>Affymetrix GeneChip</PLATFORM-TYPE>
          <PROBE>
            <PROBE-TYPE>HG-Focus</PROBE-TYPE>
            <PROBE-ID>202531_at</PROBE-ID>
          </PROBE>
          <PROBE>
            <PROBE-TYPE>HG-U133</PROBE-TYPE>
            <PROBE-ID>202531_at</PROBE-ID>
          </PROBE>
          <PROBE>
            <PROBE-TYPE>HG-U133A</PROBE-TYPE>
            <PROBE-ID>202531_at</PROBE-ID>
          </PROBE>
          <PROBE>
            <PROBE-TYPE>HG-U133A_2</PROBE-TYPE>
            <PROBE-ID>202531_at</PROBE-ID>
          </PROBE>
          <PROBE>
            <PROBE-TYPE>HG-U133_Plus_2</PROBE-TYPE>
            <PROBE-ID>202531_at</PROBE-ID>
          </PROBE>
          <PROBE>
            <PROBE-TYPE>HG-U95</PROBE-TYPE>
            <PROBE-ID>669_s_at</PROBE-ID>
          </PROBE>
          <PROBE>
            <PROBE-TYPE>HG-U95A</PROBE-TYPE>
            <PROBE-ID>669_s_at</PROBE-ID>
          </PROBE>
          <PROBE>
            <PROBE-TYPE>HG_U95Av2</PROBE-TYPE>
            <PROBE-ID>669_s_at</PROBE-ID>
          </PROBE>
          <PROBE>
            <PROBE-TYPE>HuEx-1_0</PROBE-TYPE>
            <PROBE-ID>2828595</PROBE-ID>
            <PROBE-ID>2875350</PROBE-ID>
            <PROBE-ID>2875351</PROBE-ID>
            <PROBE-ID>2875353</PROBE-ID>
            <PROBE-ID>2875356</PROBE-ID>
            <PROBE-ID>2875358</PROBE-ID>
            <PROBE-ID>2875360</PROBE-ID>
            <PROBE-ID>2875362</PROBE-ID>
            <PROBE-ID>2875363</PROBE-ID>
            <PROBE-ID>2875364</PROBE-ID>
            <PROBE-ID>2875365</PROBE-ID>
            <PROBE-ID>2875366</PROBE-ID>
            <PROBE-ID>2875372</PROBE-ID>
            <PROBE-ID>2875375</PROBE-ID>
          </PROBE>
          <PROBE>
            <PROBE-TYPE>HuGeneFL</PROBE-TYPE>
            <PROBE-ID>L05072_s_at</PROBE-ID>
          </PROBE>
        </PLATFORM>
        <PLATFORM>
          <PLATFORM-TYPE>Agilent probe set</PLATFORM-TYPE>
          <PROBE>
            <PROBE-TYPE>Human 1A Oligo Microarray:PGID215</PROBE-TYPE>
            <PROBE-ID>A_23_P41765</PROBE-ID>
          </PROBE>
          <PROBE>
            <PROBE-TYPE>Whole Human Genome Oligo Microarray:PGID247</PROBE-TYPE>
            <PROBE-ID>A_23_P41765</PROBE-ID>
          </PROBE>
        </PLATFORM>
      </PROBE-MAPPING>
    </EXPRESSION>
  </cDNAXML>
</H-Inv>