H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000034397 Accession number: BC009483 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Interferon regulatory factor 1.
 
 

Motif information
ORF

length(325),orf(204:1181)
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINK
DACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRN
KGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSD
GLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVE
VVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTN
VDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
MDATWLDSLLTPVRLPSIQAIPCAP*
a.a.
length
InterPro Name
length(315), motif(1:315) 315 IPR017431 Interferon regulatory factor-1/2 [Family]
length(114), motif(1:114) 114 IPR001346 Interferon regulatory factor [Domain]
length(112), motif(2:113) 112 IPR011991 Winged helix-turn-helix transcription repressor DNA-binding [Domain]
length(109), motif(5:113) 109 IPR001346 Interferon regulatory factor [Domain]
length(20), motif(7:26) 20 IPR001346 Interferon regulatory factor [Domain]
length(34), motif(26:59) 34 IPR019817 Interferon regulatory factor, conserved site [Conserved_site]
length(14), motif(33:46) 14 IPR001346 Interferon regulatory factor [Domain]
length(18), motif(51:68) 18 IPR001346 Interferon regulatory factor [Domain]
length(23), motif(74:96) 23 IPR001346 Interferon regulatory factor [Domain]