H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000026389 Accession number: AL390147 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to Dentin matrix protein 4; DMP-4; Protein FAM20C; Precursor;
 
 

Motif information
ORF

length(353),orf(351:1412)
GPVGSWVPRVPKAQGGPEEAGAPPHFSYEEPSTSRLPPAPGGFLSDKPFL
FLSCFLRQTREQETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAG
RMVNMTKEIRDVTRDKKLWRTFFISPANNICFYGECSYYCSTEHALCGKP
DQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQ
TPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGR
GFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRG
DQVAPVLYQPHLEALDRRLRVVLKAVRDCVERDGLHSVVDDDLDTEHRAA
SAR*
a.a.
length
InterPro Name
length(281), motif(57:337) 281 IPR009581 Protein of unknown function DUF1193 [Family]