H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000026389 Accession number: AL390147 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Similar to Extracellular serine/threonine protein kinase FAM20C; EC=2.7.11.1; Dentin matrix protein 4; DMP-4; Golgi-enriched fraction casein kinase; GEF-CK; Protein FAM20C; Precursor;
 
 

Motif information
ORF

length(353),orf(351:1412)
GPVGSWVPRVPKAQGGPEEAGAPPHFSYEEPSTSRLPPAPGGFLSDKPFL
FLSCFLRQTREQETPPDFFYFSDYERHNAEIAAFHLDRILDFRRVPPVAG
RMVNMTKEIRDVTRDKKLWRTFFISPANNICFYGECSYYCSTEHALCGKP
DQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQ
TPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGR
GFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRG
DQVAPVLYQPHLEALDRRLRVVLKAVRDCVERDGLHSVVDDDLDTEHRAA
SAR*
a.a.
length
InterPro Name
length(298), motif(56:353) 298 IPR024869 FAM20 [Family]
length(221), motif(122:342) 221 IPR009581 Domain of unknown function DUF1193 [Domain]