H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000015863 Accession number: AK090996 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Thy-1 membrane glycoprotein; CDw90; Thy-1 antigen; AltName: CD_antigen=CD90; Precursor;
 
 

Motif information
ORF

length(161),orf(1041:1526)
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQY
EFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEG
TYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSL
SLLQATDFMSL*
a.a.
length
InterPro Name
length(117), motif(5:121) 117 IPR007110 Immunoglobulin-like domain [Domain]
length(101), motif(23:123) 101 IPR003599 Immunoglobulin subtype [Domain]
length(93), motif(30:122) 93 IPR013783 Immunoglobulin-like fold [Domain]
length(73), motif(32:104) 73 IPR013151 Immunoglobulin [Domain]