H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000015863 Accession number: AK090996 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: Thy-1 membrane glycoprotein; CDw90; Thy-1 antigen; AltName: CD_antigen=CD90; Precursor;
 
 

Transcript original information
Accession number AK090996.1
CAGE tag ID NA
EST ID NA
Clone Number BRAWH2002125
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (THY1) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (THY1);
Sequence data provider Project:FLJ; Provider:FLJ/HRI; 
Annotation project H-Invitational FLcDNA
Length of cDNA 2757[bp] (No. of exon:4)[A:619 T:532 G:750 C:856]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type brain
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) NA
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0010195
Genomic location  G-integra Help Chromosome 11
Location 11q23.3
Position 119288887- 119294838
Strand -
Possible duplicated location(s) NA
Gene structure 4 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:7070
KEGG GENES KEGG GENES(7070)
GeneCard GeneCardTHY1*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000080514
Predicted CDS 1041..1526;  161[aa];  Orientation:+3; 
Codon Adaptation Index (CAI). 0.798
Database links RefSeq NP_006279
UniProt P04216
CCDS CCDS8424

Motif information
ORF

length(161),orf(1041:1526)
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQY
EFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEG
TYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSL
SLLQATDFMSL*
a.a.
length
InterPro Name
length(117), motif(5:121) 117 IPR007110 Immunoglobulin-like domain [Domain]
length(101), motif(23:123) 101 IPR003599 Immunoglobulin subtype [Domain]
length(93), motif(30:122) 93 IPR013783 Immunoglobulin-like fold [Domain]
length(73), motif(32:104) 73 IPR013151 Immunoglobulin [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000015863
H-Inv cluster ID Locus viewHIX0010195
Accession number AK090996.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Thy-1 membrane glycoprotein; CDw90; Thy-1 antigen; AltName: CD_antigen=CD90; Precursor;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (P04216)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 286469076830341094446815489334179740051915921819349973ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol THY1
HGNC aliases NA
HGNC name Thy-1 cell surface antigen
DDBJ NA
UniProt THY1
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000080514
No. of interaction 3
Interaction partner(s) HIP000027440HIP000060164HIP000112411
BIND NA
DIP NA
MINT NA
HPRD 00411;  00655;  01080;  01428;  01903; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:7070
KEGG GENES KEGG GENES(7070)
GeneCard GeneCardTHY1*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function protein binding (GO:0005515); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT extracellular; 
Target P signal peptide
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
32 122 1dr9A1 4e-05 16.5 91/105 b.1.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA020421;  AGhsC021111; 
Affymetrix
GeneChip
HG-Focus 208850_s_at; 
HG-U133 208850_s_at;  208851_s_at;  213869_x_at; 
HG-U133A 208850_s_at;  208851_s_at;  213869_x_at; 
HG-U133A_2 208850_s_at;  208851_s_at;  213869_x_at; 
HG-U133B NA
HG-U133_Plus_2 208850_s_at;  208851_s_at;  213869_x_at; 
HG-U95 39395_at; 
HG-U95A 39395_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 3352170;  3352171;  3352172;  3352207;  3352208;  3352209;  3394416;  3394417;  3394418;  3394419;  3394420;  3394421;  3394422;  3394423;  3394424;  3394425;  3394430;  3394436; 
HuGeneFL M11749_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P36364;  A_23_P47756; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P36364; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Mus sp. (Mouse) BC054436 MGI:98747 G-integraG-integra
Orthology Bos sp. (Cow) BC104530 G-integraG-integra
Orthology Pongo sp. (Orangutan) CR861077 G-integraG-integra
Orthology Pan sp. (Chimpanzee) ENSPTRT00000008133 G-integraG-integra
Orthology Equus sp. (Horse) EU881920 G-integraG-integra
Orthology Macaca sp. (Macaque) U93310 G-integraG-integra
Orthology Rattus sp. (Rat) X03150 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001380419 G-integraG-integra
Orthology Canis sp. (Dog) XM_546483 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
56 .. 56 C/T rs142534164 - 5'UTR
63 .. 63 C/G rs181595435 - 5'UTR
107 .. 107 G/C rs139441841 - 5'UTR
117 .. 117 G/A rs76290184 - 5'UTR
143 .. 143 T/A rs56368892 - 5'UTR
216 .. 216 G/A rs189585658 - 5'UTR
226 .. 226 G/A rs55676289 - 5'UTR
245 .. 245 G/A rs56223348 - 5'UTR
262 .. 262 G/A rs147545779 - 5'UTR
274 .. 274 A/G rs56178844 - 5'UTR
303 .. 303 A/T rs55733730 - 5'UTR
368 .. 368 G/A rs45506295 - 5'UTR
388 .. 388 G/A rs184287978 - 5'UTR
417 .. 417 C/T rs140944676 - 5'UTR
423 .. 423 T/C rs56189868 - 5'UTR
425 .. 425 G/C rs79525057 - 5'UTR
513 .. 513 C/A rs180930657 - 5'UTR
525 .. 525 T/C rs55997940 - 5'UTR
549 .. 549 T/C rs11574653 + 5'UTR
560 .. 560 G/A rs185030375 - 5'UTR
575 .. 575 A/G rs192105717 - 5'UTR
690 .. 690 G/A rs187663323 - 5'UTR
697 .. 697 G/A rs3862600 - 5'UTR
698 .. 698 G/A rs1864290 + 5'UTR
702 .. 702 G/A rs2082050 + 5'UTR
740 .. 740 C/T rs1864291 + 5'UTR
782 ^ 783 -/C rs142568099 - 5'UTR
814 .. 814 C/T rs184735627 - 5'UTR
856 .. 856 C/T rs56041994 - 5'UTR
899 .. 899 C/T rs4397862 - 5'UTR
926 .. 926 C/A rs55933700 - 5'UTR
973 .. 973 G/A rs188008516 - 5'UTR
1062 .. 1062 G/A rs149084200 - CDS Nonsynonymous[Ala8Thr]
1065 .. 1065 C/G rs191290647 - CDS Nonsynonymous[Leu9Val]
1135 .. 1135 A/G rs202221625 - CDS Nonsynonymous[Gln32Arg]
1144 .. 1144 G/A rs201203569 - CDS Nonsynonymous[Arg35His]
1145 .. 1145 T/A rs11574654 + CDS Synonymous[Arg35Arg]
1202 .. 1202 G/A rs199847788 - CDS Synonymous[Leu54Leu]
1253 .. 1253 G/A rs35922941 - CDS Synonymous[Glu71Glu]
1263 .. 1263 C/A rs11546392 + CDS Nonsynonymous[Arg75Ser]
1266 .. 1266 T/C rs144701667 - CDS Nonsynonymous[Ser76Pro]
1317 .. 1317 G/A rs142564004 - CDS Nonsynonymous[Ala93Thr]
1343 .. 1343 C/G rs11546394 + CDS Synonymous[Thr101Thr]
1348 .. 1348 C/T rs45441500 - CDS Nonsynonymous[Thr103Met]
1391 .. 1391 C/A rs11546391 + CDS Synonymous[Ser117Ser]
1397 .. 1397 C/T rs111763470 - CDS Synonymous[Asn119Asn]
1398 .. 1398 G/A rs200552451 - CDS Nonsynonymous[Val120Ile]
1420 .. 1420 T/G rs147718110 - CDS Nonsynonymous[Leu127Arg]
1435 .. 1435 G/T rs145708047 - CDS Nonsynonymous[Gly132Val]
1610 .. 1610 G/C rs1054735 + 3'UTR
1642 .. 1642 C/A rs140982940 - 3'UTR
1660 .. 1660 G/C/A rs111339732 - 3'UTR
1712 .. 1712 T/C rs151091095 - 3'UTR
1725 .. 1725 C/A rs112225059 - 3'UTR
1801 .. 1801 G/A rs12291644 - 3'UTR
1856 .. 1856 G/A rs191219058 - 3'UTR
1874 .. 1874 G/T rs13770 - 3'UTR
2000 .. 2000 C/G rs114912758 - 3'UTR
2061 .. 2061 G/A rs142948083 - 3'UTR
2123 ^ 2124 -/A rs201075089 - 3'UTR
2242 .. 2242 A/G rs186796680 - 3'UTR
2249 .. 2249 G/A rs148557726 - 3'UTR
2291 .. 2291 G/A rs112627114 - 3'UTR
2392 .. 2392 C/T rs1055370 + 3'UTR
2458 .. 2458 C/T rs1064070 + 3'UTR
2481 .. 2481 C/T rs144747617 - 3'UTR
2509 .. 2509 G/A rs182215894 - 3'UTR
2531 .. 2531 C/T rs11546395 - 3'UTR
2569 .. 2569 C/T rs113417916 - 3'UTR
2601 .. 2601 A/G rs188844162 - 3'UTR
2653 .. 2653 C/T rs142012436 - 3'UTR
2654 .. 2654 G/C rs140031650 - 3'UTR
2693 .. 2693 A/C rs1055922 + 3'UTR
2701 .. 2701 T/C rs183560972 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
MIRb 140 200 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer