H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000013556 Accession number: AK056942 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: E3 ubiquitin-protein ligase TRIM63.
 
 

Transcript original information
Accession number AK056942.1
CAGE tag ID NA
EST ID NA
Clone Number SKMUS1000064
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (TRIM63) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (TRIM63);
Sequence data provider Project:FLJ; Provider:FLJ/HRI; 
Annotation project H-Invitational FLcDNA
Length of cDNA 1764[bp] (No. of exon:9)[A:466 T:379 G:517 C:402]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type skeletal muscle
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0000284
Genomic location  G-integra Help Chromosome 1
Location 1p36.11
Position 26377798- 26394121
Strand -
Possible duplicated location(s) NA
Gene structure 9 exon(s)
Database links RefSeq NM_032588
Ensembl ENST00000374272ENST00000483052
Entrez Gene Entrez Gene ID:84676
KEGG GENES KEGG GENES(84676)
GeneCard GeneCardTRIM63*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000043958
Predicted CDS 137..1198;  353[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.847
Database links RefSeq NP_115977
UniProt Q969Q1
CCDS CCDS273

Motif information
ORF

length(353),orf(137:1198)
MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAND
IFQAANPYWTSRGSSVSMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVEN
IIDIYKQECSSRPLQKGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGI
HKACEVAPLQSVFQGQKTELNNCISMLVAGNDRVQTIITQLEDSRRVTKE
NSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQEKKLSFIEALIQQYQ
EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ
GFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEE
GHQ*
a.a.
length
InterPro Name
length(120), motif(10:129) 120 IPR013083 Zinc finger, RING/FYVE/PHD-type [Domain]
length(56), motif(23:78) 56 IPR018957 Zinc finger, C3HC4 RING-type [Domain]
length(56), motif(23:78) 56 IPR001841 Zinc finger, RING-type [Domain]
length(57), motif(23:79) 57 IPR001841 Zinc finger, RING-type [Domain]
length(10), motif(39:48) 10 IPR017907 Zinc finger, RING-type, conserved site [Conserved_site]
length(43), motif(117:159) 43 IPR000315 Zinc finger, B-box [Domain]
length(33), motif(120:152) 33 IPR000315 Zinc finger, B-box [Domain]
length(59), motif(267:325) 59 IPR017903 COS domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000013556
H-Inv cluster ID Locus viewHIX0000284
Accession number AK056942.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition E3 ubiquitin-protein ligase TRIM63.
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (NP_115977)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens protein.
Experimental evidence Protein evidence
PubMed ID NA
Gene family/group Gene family H-Inv gene family/group ID HIF0001508
Gene family/group name Zinc finger, C3HC4 RING-type (IPR018957).
Evidence motif (InterPro) ID IPR018957
Gene symbol/name HGNC symbol TRIM63
HGNC aliases "ring finger protein 28", "tripartite motif-containing 63"
HGNC name tripartite motif containing 63
DDBJ NA
UniProt NA
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000043958
No. of interaction 42
Interaction partner(s) HIP000021862HIP000022399HIP000022749HIP000023802HIP000024116HIP000024538HIP000024752HIP000026558HIP000029072HIP000029217HIP000030490HIP000030585HIP000031239HIP000031968HIP000034140HIP000035818HIP000035951HIP000037565HIP000043958HIP000055308HIP000061670HIP000066039HIP000072251HIP000076905HIP000079776HIP000083435HIP000085076HIP000089945HIP000092816HIP000095117HIP000096048HIP000096844HIP000098180HIP000099420HIP000101521HIP000102198HIP000106111HIP000109262HIP000114548HIP000140040HIP000141605HIP000186203
BIND 312440;  312441; 
DIP NA
MINT MINT-6492181;  MINT-6492197;  MINT-6492209;  MINT-6492226;  MINT-6492252;  MINT-6503390;  MINT-6503400;  MINT-6503410;  MINT-6503420;  MINT-6503440;  MINT-6503450;  MINT-6503460;  MINT-6503470;  MINT-6503480;  MINT-6503490;  MINT-6503500;  MINT-6503510;  MINT-6503520;  MINT-6503530;  MINT-6503540;  MINT-6503550;  MINT-6503560;  MINT-6503570;  MINT-6503590;  MINT-6503600;  MINT-6503610;  MINT-6503620;  MINT-6503630;  MINT-6503640;  MINT-6503650;  MINT-6503660;  MINT-6503670;  MINT-6503680;  MINT-6503690;  MINT-6503700;  MINT-6503710;  MINT-6503720; 
HPRD 00015;  00016;  00018;  00030;  00031;  00044;  00426;  00514;  01181;  01196;  01529;  01530;  01787;  01843;  01875;  01986;  02093;  02209;  02980;  03734;  03799;  03957;  04666;  05133;  05725;  05843;  05927;  05928;  09045;  10403;  10811;  11370;  11398;  11745;  11746;  11769;  12376;  16059; 
IntAct NA
Database links RefSeq NM_032588
Ensembl ENST00000374272ENST00000483052
Entrez Gene Entrez Gene ID:84676
KEGG GENES KEGG GENES(84676)
GeneCard GeneCardTRIM63*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Zinc finger, C3HC4 RING-type (IPR018957). Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function zinc ion binding (GO:0008270);  protein binding (GO:0005515); 
Cellular component intracellular (GO:0005622); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT nuclear;  cytosol;  golgi apparatus;  mitochondria;  peroxisome;  plasma membrane; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:26-Mar-2013
Start End PDB_ID E-value Identity Coverage SCOP_ID
1 120 1jm7A 2e-09 24.0 100/103 g.44.1.1
119 169 2d8uA1 7e-21 100.0 51/51 g.43.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL muscle/heart; 
Probe
information DNAProbeLocator
AceGene AGhsB050521;  AGhsB050823; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 236972_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 236972_at; 
HG-U133_Plus_2 236972_at; 
HG-U95 77301_at; 
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E 77301_at; 
HG-U95Av2 NA
HuEx-1_0 2402537;  2402538;  2402539;  2402541;  2402542;  2402543;  2402545;  2402548;  2402549;  2402550;  2402551; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P114983; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P114983; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  115665116600155600600975605225605606606788606852606928607317607671608543608553608995610320612367612596
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(84676)
Disease Entrez Gene ID:(84676)
Substance Entrez Gene ID:(84676)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Evolutionary information  Evola Help Last modified:26-Mar-2013
Relationship Species Accession number MGI Links
Orthology Danio sp. (Zebrafish) BC049414 G-integraG-integra
Orthology Rattus sp. (Rat) BC061824 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC075897 G-integraG-integra
Orthology Bos sp. (Cow) BC112721 G-integraG-integra
Orthology Gallus sp. (Chicken) BX931246 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) CR670382 G-integraG-integra
Orthology Mus sp. (Mouse) DQ229108 G-integraG-integra
Orthology Equus sp. (Horse) ENSECAT00000026380 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000010271 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000002021 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000155215 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001108306 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001369455 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_524625 G-integraG-integra
Orthology Canis sp. (Dog) XM_544488 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
8 .. 8 G/C rs4543781 - 5'UTR
120 .. 120 T/C rs112789849 - 5'UTR
148 .. 148 G/A rs3795690 + CDS Synonymous[Lys4Lys]
271 .. 271 G/C rs61760891 - CDS Synonymous[Arg45Arg]
298 .. 298 T/G rs41284327 - CDS Synonymous[Ala54Ala]
399 .. 399 G/C rs41284325 - CDS Nonsynonymous[Gly88Ala]
403 .. 403 T/G rs35123100 + CDS Synonymous[Val89Val]
442 .. 442 C/T rs34009998 + CDS Synonymous[Ile102Ile]
761 .. 761 C/T rs35131871 + CDS Synonymous[Leu209Leu]
781 .. 781 G/A rs117577030 - CDS Synonymous[Thr215Thr]
845 .. 845 A/G rs2275950 + CDS Nonsynonymous[Lys237Glu]
941 .. 941 G/A rs61749355 - CDS Nonsynonymous[Glu269Lys]
1177 .. 1177 G/A rs61749354 - CDS Synonymous[Gly347Gly]
1200 .. 1200 G/A rs77965623 - 3'UTR
1351 .. 1351 G/C rs72664101 - 3'UTR
1439 .. 1439 C/G rs35773319 - 3'UTR
1552 .. 1552 G/A rs41311278 - 3'UTR
1560 .. 1560 A/G rs1135251 + 3'UTR
1682 .. 1682 T/C rs1135253 + 3'UTR
1727 .. 1727 T/C rs2275946 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer