H-InvDB x AHG DB
Transcript view
H-InvDB_9.0 released on May 27, 2015.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000013556 Accession number: AK056942 Created date: 26-Mar-2013 Last modified: 27-May-2015
Definition: E3 ubiquitin-protein ligase TRIM63; EC=6.3.2.-; Iris RING finger protein; Muscle-specific RING finger protein 1; MuRF-1; MuRF1; RING finger protein 28; Striated muscle RING zinc finger protein; Tripartite motif-containing protein 63;
 
 

Transcript original information
Accession number AK056942.1
CAGE tag ID NA
EST ID NA
Clone Number SKMUS1000064
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (TRIM63) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (TRIM63);
Sequence data provider Project:FLJ; Provider:FLJ/HRI; 
Annotation project H-Invitational FLcDNA
Length of cDNA 1764[bp] (No. of exon:9)[A:466 T:379 G:517 C:402]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type skeletal muscle
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0000284
Genomic location  G-integra Help Chromosome 1
Location 1p36.11
Position 26377798- 26394121
Strand -
Possible duplicated location(s) NA
Gene structure 9 exon(s)
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:84676
KEGG GENES KEGG GENES(84676)
GeneCard GeneCardTRIM63*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000043958
Predicted CDS 137..1198;  353[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.846
Database links RefSeq NP_115977
UniProt Q969Q1
CCDS CCDS273

Motif information
ORF

length(353),orf(137:1198)
MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCAND
IFQAANPYWTSRGSSVSMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVEN
IIDIYKQECSSRPLQKGSHPMCKEHEDEKINIYCLTCEVPTCSMCKVFGI
HKACEVAPLQSVFQGQKTELNNCISMLVAGNDRVQTIITQLEDSRRVTKE
NSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQEKKLSFIEALIQQYQ
EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ
GFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEE
GHQ*
a.a.
length
InterPro Name
length(103), motif(10:112) 103 IPR013083 Zinc finger, RING/FYVE/PHD-type [Domain]
length(57), motif(23:79) 57 IPR001841 Zinc finger, RING-type [Domain]
length(56), motif(23:78) 56 IPR001841 Zinc finger, RING-type [Domain]
length(10), motif(39:48) 10 IPR017907 Zinc finger, RING-type, conserved site [Conserved_site]
length(43), motif(117:159) 43 IPR000315 Zinc finger, B-box [Domain]
length(40), motif(120:159) 40 IPR000315 Zinc finger, B-box [Domain]
length(33), motif(120:152) 33 IPR000315 Zinc finger, B-box [Domain]
length(59), motif(267:325) 59 IPR017903 COS domain [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000013556
H-Inv cluster ID Locus viewHIX0000284
Accession number AK056942.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help Representative H-Inv IDRepresentative transcript;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition E3 ubiquitin-protein ligase TRIM63; EC=6.3.2.-; Iris RING finger protein; Muscle-specific RING finger protein 1; MuRF-1; MuRF1; RING finger protein 28; Striated muscle RING zinc finger protein; Tripartite motif-containing protein 63;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q969Q1)  [Identity/coverage = 100.0%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 1124378211283016116796331192760512107412147020391548933416710414182224701846862018795805ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol TRIM63
HGNC aliases "ring finger protein 28", "tripartite motif-containing 63", "tripartite motif containing 63"
HGNC name tripartite motif containing 63, E3 ubiquitin protein ligase
DDBJ NA
UniProt TRIM63
EC number EC 6.3.2.-Acid-Amino-Acid Ligases (Peptide Synthases); 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000043958
No. of interaction 4
Interaction partner(s) HIP000027692HIP000034631HIP000067653HIP000095887
BIND 312440; 
DIP NA
MINT MINT-6492181;  MINT-6492197;  MINT-6492209;  MINT-6492226;  MINT-6492252;  MINT-6503390;  MINT-6503400;  MINT-6503410;  MINT-6503420;  MINT-6503440;  MINT-6503450;  MINT-6503460;  MINT-6503470;  MINT-6503480;  MINT-6503490;  MINT-6503500;  MINT-6503510;  MINT-6503520;  MINT-6503530;  MINT-6503540;  MINT-6503550;  MINT-6503560;  MINT-6503570;  MINT-6503590;  MINT-6503600;  MINT-6503610;  MINT-6503620;  MINT-6503630;  MINT-6503640;  MINT-6503650;  MINT-6503660;  MINT-6503670;  MINT-6503680;  MINT-6503690;  MINT-6503700;  MINT-6503710;  MINT-6503720; 
HPRD 00015;  00016;  00018;  00030;  00031;  00044;  00426;  00514;  01181;  01196;  01529;  01530;  01787;  01843;  01875;  01986;  02093;  02209;  02980;  03734;  03799;  03957;  04666;  05133;  05725;  05927;  05928;  07365;  09045;  10403;  10811;  11370;  11398;  11745;  11746;  11769;  12376;  16059;  17156; 
IntAct NA
Database links RefSeq NA
Ensembl NA
Entrez Gene Entrez Gene ID:84676
KEGG GENES KEGG GENES(84676)
GeneCard GeneCardTRIM63*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Human curated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function zinc ion binding (GO:0008270);  protein binding (GO:0005515); 
Cellular component intracellular (GO:0005622); 

Subcellular localization information  Last modified:27-May-2015
WoLF PSORT nuclear;  cytosol;  golgi apparatus;  mitochondria;  peroxisome;  plasma membrane; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:27-May-2015
Start End PDB_ID E-value Identity Coverage SCOP_ID
1 120 1jm7A 2e-09 24.0 100/103 g.44.1.1
119 169 2d8uA1 7e-21 100.0 51/51 g.43.1.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:27-May-2015
Tissue-specific expression  H-ANGEL muscle/heart; 
Probe
information DNAProbeLocator
AceGene AGhsB050521;  AGhsB050823; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 236972_at; 
HG-U133A NA
HG-U133A_2 NA
HG-U133B 236972_at; 
HG-U133_Plus_2 236972_at; 
HG-U95 77301_at; 
HG-U95A NA
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E 77301_at; 
HG-U95Av2 NA
HuEx-1_0 2402537;  2402538;  2402539;  2402541;  2402542;  2402543;  2402545;  2402548;  2402549;  2402550;  2402551; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P114983; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P114983; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Evolutionary information  Evola Help Last modified:27-May-2015
Relationship Species Accession number MGI Links
Orthology Danio sp. (Zebrafish) BC049414 G-integraG-integra
Orthology Rattus sp. (Rat) BC061824 G-integraG-integra
Orthology Danio sp. (Zebrafish) BC075897 G-integraG-integra
Orthology Bos sp. (Cow) BC112721 G-integraG-integra
Orthology Gallus sp. (Chicken) BX931246 G-integraG-integra
Orthology Tetraodon sp. (Tetraodon) CR670382 G-integraG-integra
Orthology Mus sp. (Mouse) DQ229108 G-integraG-integra
Orthology Equus sp. (Horse) ENSECAT00000026380 G-integraG-integra
Orthology Oryzias sp. (Medaka) ENSORLT00000010271 G-integraG-integra
Orthology Pongo sp. (Orangutan) ENSPPYT00000002021 G-integraG-integra
Orthology Takifugu sp. (Fugu) SINFRUT00000155215 G-integraG-integra
Orthology Macaca sp. (Macaque) XM_001108306 G-integraG-integra
Orthology Monodelphis sp. (Opossum) XM_001369455 G-integraG-integra
Orthology Pan sp. (Chimpanzee) XM_524625 G-integraG-integra
Orthology Canis sp. (Dog) XM_544488 G-integraG-integra
Phylogenetic tree [View by ATV]
Neighbor-joining (phb) 
Related H-InvDB links EvolaEvoladN/dS (under constraction); 

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
8 .. 8 G/C rs4543781 - 5'UTR
30 .. 30 A/G rs142788579 - 5'UTR
39 .. 39 G/A rs140414331 - 5'UTR
99 .. 99 G/A rs188797224 - 5'UTR
120 .. 120 T/C rs112789849 - 5'UTR
148 .. 148 G/A rs3795690 + CDS Synonymous[Lys4Lys]
178 .. 178 G/T rs201122923 - CDS Nonsynonymous[Met14Ile]
185 .. 185 T/C rs202242110 - CDS Synonymous[Leu17Leu]
214 .. 214 C/T rs200467938 - CDS Synonymous[Cys26Cys]
271 .. 271 G/C rs61760891 - CDS Synonymous[Arg45Arg]
279 .. 279 C/T rs140523053 - CDS Nonsynonymous[Ala48Val]
298 .. 298 T/G rs41284327 - CDS Synonymous[Ala54Ala]
306 .. 306 C/T rs146641597 - CDS Nonsynonymous[Pro57Leu]
320 .. 320 C/T rs148561702 - CDS Nonsynonymous[Arg62Trp]
351 .. 351 G/A rs149398763 - CDS Nonsynonymous[Arg72His]
357 .. 357 G/A rs142710853 - CDS Nonsynonymous[Arg74His]
360 .. 360 G/A rs200811483 - CDS Nonsynonymous[Cys75Tyr]
399 .. 399 G/C rs41284325 - CDS Nonsynonymous[Gly88Ala]
403 .. 403 T/G rs35123100 + CDS Synonymous[Val89Val]
428 .. 428 G/A rs201301435 - CDS Nonsynonymous[Val98Met]
442 .. 442 C/T rs34009998 + CDS Synonymous[Ile102Ile]
470 .. 470 C/T rs145769000 - CDS Nonsynonymous[Arg112Trp]
474 .. 474 C/T rs199936688 - CDS Nonsynonymous[Pro113Leu]
475 .. 475 G/A rs141218809 - CDS Synonymous[Pro113Pro]
511 .. 511 C/T rs144196126 - CDS Synonymous[His125His]
512 .. 512 G/A rs139426966 - CDS Nonsynonymous[Glu126Lys]
514 .. 514 A/T rs142601731 - CDS Nonsynonymous[Glu126Asp]
531 .. 531 T/C rs148433331 - CDS Nonsynonymous[Ile132Thr]
561 .. 561 G/A rs147379770 - CDS Nonsynonymous[Cys142Tyr]
570 .. 570 G/A rs202072815 - CDS Nonsynonymous[Cys145Tyr]
573 .. 573 A/C rs140391981 - CDS Nonsynonymous[Lys146Thr]
574 .. 574 G/C rs149451805 - CDS Nonsynonymous[Lys146Asn]
613 .. 613 G/A rs199867640 - CDS Synonymous[Leu159Leu]
644 .. 644 C/T rs150788546 - CDS Synonymous[Leu170Leu]
655 .. 655 T/A rs199956613 - CDS AA-STOP[Cys173*]
662 .. 662 A/T rs201919997 - CDS Nonsynonymous[Met176Leu]
683 .. 683 C/T rs148233667 - CDS Nonsynonymous[Arg183Cys]
684 .. 684 G/A rs139003247 - CDS Nonsynonymous[Arg183His]
719 .. 719 C/T rs200823488 - CDS Nonsynonymous[Arg195Cys]
722 .. 722 C/G rs145057954 - CDS Nonsynonymous[Arg196Gly]
723 .. 723 G/A rs138298827 - CDS Nonsynonymous[Arg196Gln]
760 .. 760 G/A rs183036213 - CDS Synonymous[Glu208Glu]
761 .. 761 C/T rs35131871 + CDS Synonymous[Leu209Leu]
781 .. 781 G/A rs117577030 - CDS Synonymous[Thr215Thr]
782 .. 782 T/C rs191648198 - CDS Synonymous[Leu216Leu]
789 .. 789 C/T rs141049472 - CDS Nonsynonymous[Ala218Val]
795 .. 795 T/C rs145551009 - CDS Nonsynonymous[Leu220Pro]
845 .. 845 A/G rs2275950 + CDS Nonsynonymous[Lys237Glu]
862 .. 862 C/G rs142518424 - CDS Nonsynonymous[Ile242Met]
875 .. 875 C/T rs148395034 - CDS AA-STOP[Gln247*]
917 .. 917 G/T rs149312738 - CDS AA-STOP[Glu261*]
941 .. 941 G/A rs61749355 - CDS Nonsynonymous[Glu269Lys]
955 .. 955 C/T rs138337721 - CDS Synonymous[Ala273Ala]
1004 .. 1004 T/C rs140448843 - CDS Nonsynonymous[Ser290Pro]
1078 .. 1078 C/T rs143233499 - CDS Synonymous[His314His]
1087 .. 1087 C/T rs147739771 - CDS Synonymous[Asp317Asp]
1089 .. 1089 C/A rs201397530 - CDS Nonsynonymous[Ala318Asp]
1109 .. 1109 G/C rs199707976 - CDS Nonsynonymous[Gly325Arg]
1148 .. 1148 G/T rs145591989 - CDS Nonsynonymous[Asp338Tyr]
1177 .. 1177 G/A rs61749354 - CDS Synonymous[Gly347Gly]
1187 .. 1187 G/A rs202001619 - CDS Nonsynonymous[Gly351Arg]
1200 .. 1200 G/A rs77965623 - 3'UTR
1233 .. 1233 G/A rs200874849 - 3'UTR
1296 .. 1296 G/A rs192045840 - 3'UTR
1351 .. 1351 G/C rs72664101 - 3'UTR
1439 .. 1439 C/G rs35773319 - 3'UTR
1552 .. 1552 G/A rs41311278 - 3'UTR
1560 .. 1560 A/G rs1135251 + 3'UTR
1650 .. 1650 C/A rs146443012 - 3'UTR
1682 .. 1682 T/C rs1135253 + 3'UTR
1727 .. 1727 T/C rs2275946 - 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
No data available
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
No data available
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer