H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000000610 Accession number: AB020700 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: WD repeat-containing protein 47 isoform 3.
 
 

Motif information
ORF

length(919),orf(224:2983)
MTAEETVNVKEVEIIKLILDFLNSKKLHISMLALEKESGVINGLFSDDML
FLRQLILDGQWDEVLQFIQPLECMEKFDKKRFRYIILKQKFLEALCVNNA
MSAEDEPQHLEFTMQEAVQCLHALEEYCPSKDDYSKLCLLLTLPRLTNHA
EFKDWNPSTARVHCFEEACVMVAEFIPADRKLSEAGFKASNNRLFQLVMK
GLLYECCVEFCQSKATGEEITESEVLLGIDLLCGNGCDDLDLSLLSWLQN
LPSSVFSCAFEQKMLNIHVDKLLKPTKAAYADLLTPLISKLSPYPSSPMR
RPQSADAYMTRSLNPALDGLTCGLTSHDKRISDLGNKTSPMSHSFANFHY
PGVQNLSRSLMLENTECHSIYEESPERDTPVDAQRPIGSEILGQSSVSEK
EPANGAQNPGPAKQEKNELRDSTEQFQEYYRQRLRYQQHLEQKEQQRQIY
QQMLLEGGVNQEDGPDQQQNLTEQFLNRSIQKLGELNIGMDGLGNEVSAL
NQQCNGSKGNGSNGSSVTSFTTPPQDSSQRLTHDASNIHTSTPRNPGSTN
HIPFLEESPCGSQISSEHSVIKPPLGDSPGSLSRSKGEEDDKSKKQFVCI
NILEDTQAVRAVAFHPAGGLYAVGSNSKTLRVCAYPDVIDPSAHETPKQP
VVRFKRNKHHKGSIYCVAWSPCGQLLATGSNDKYVKVLPFNAETCNATGP
DLEFSMHDGTIRDLAFMEGPESGGAILISAGAGDCNIYTTDCQRGQGLHA
LSGHTGHILALYTWSGWMIASGSQDKTVRFWDLRVPSCVRVVGTTFHGTG
SAVASVAVDPSGRLLATGQEDSSCMLYDIRGGRMVQSYHPHSSDVRSVRF
SPGAHYLLTGSYDMKIKVTDLQGDLTKQLPIMVVGEHKDKVIQCRWHTQD
LSFLSSSADRTVTLWTYNG*
a.a.
length
InterPro Name
length(33), motif(10:42) 33 IPR006594 LisH dimerisation motif [Domain]
length(58), motif(45:102) 58 IPR006595 CTLH, C-terminal LisH motif [Domain]
length(39), motif(596:634) 39 IPR001680 WD40 repeat [Repeat]
length(315), motif(604:918) 315 IPR015943 WD40/YVTN repeat-like-containing domain [Domain]
length(27), motif(606:632) 27 IPR019781 WD40 repeat, subgroup [Repeat]
length(311), motif(606:916) 311 IPR011046 WD40 repeat-like-containing domain [Domain]
length(43), motif(647:689) 43 IPR001680 WD40 repeat [Repeat]
length(31), motif(657:687) 31 IPR019782 WD40 repeat 2 [Repeat]
length(263), motif(657:919) 263 IPR017986 WD40-repeat-containing domain [Domain]
length(30), motif(658:687) 30 IPR019781 WD40 repeat, subgroup [Repeat]
length(45), motif(697:741) 45 IPR001680 WD40 repeat [Repeat]
length(39), motif(744:782) 39 IPR001680 WD40 repeat [Repeat]
length(37), motif(746:782) 37 IPR019781 WD40 repeat, subgroup [Repeat]
length(41), motif(751:791) 41 IPR019782 WD40 repeat 2 [Repeat]
length(15), motif(769:783) 15 IPR019775 WD40 repeat, conserved site [Conserved_site]
length(40), motif(789:828) 40 IPR001680 WD40 repeat [Repeat]
length(35), motif(794:828) 35 IPR019781 WD40 repeat, subgroup [Repeat]
length(42), motif(796:837) 42 IPR019782 WD40 repeat 2 [Repeat]
length(40), motif(831:870) 40 IPR001680 WD40 repeat [Repeat]
length(34), motif(835:868) 34 IPR019781 WD40 repeat, subgroup [Repeat]
length(35), motif(838:872) 35 IPR019782 WD40 repeat 2 [Repeat]
length(40), motif(877:916) 40 IPR001680 WD40 repeat [Repeat]
length(35), motif(881:915) 35 IPR019781 WD40 repeat, subgroup [Repeat]
length(36), motif(884:919) 36 IPR019782 WD40 repeat 2 [Repeat]