H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000000192 Accession number: AB007944 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Glycosaminoglycan xylosylkinase precursor.
 
 

Motif information
ORF

length(409),orf(337:1566)
MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRV
ELAPKLDHTLQSPWEIAAQWVVPREVYPEETPELGAVMHAMATKKIIKAD
VGYKGTQLKALLILEGGQKVVFKPKRYSRDHVVEGEPYAGYDRHNAEVAA
FHLDRILGFHRAPLVVGRFVNLRTEIKPVATEQLLSTFLTVGNNTCFYGK
CYYCRETEPACADGDIMEGSVTLWLPDVWPLQKHRHPWGRTYREGKLARW
EYDESYCDAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDE
GASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNGVL
KSALKSAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQCTDQFGMDTVLV
EDRMPLSHL*
a.a.
length
InterPro Name
length(384), motif(14:397) 384 IPR009581 Protein of unknown function DUF1193 [Family]