H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
H-Invitational ID: HIT000000190 Accession number: AB007942 Created date: 26-Mar-2013 Last modified: 26-Mar-2013
Definition: Similar to Uncharacterized protein; Fragment;
 
 

Transcript original information
Accession number AB007942.1
CAGE tag ID NA
EST ID NA
Clone Number HH0220
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (DNAJC6) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (DNAJC6);
Sequence data provider Provider:KDRI
Annotation project H-Invitational FLcDNA
Length of cDNA 5747[bp] (No. of exon:19)[A:1720 T:1597 G:1199 C:1231]
Devision HUM
Molecular type mRNA
Library origin Cell type NA
Tissue type brain
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGAAG;  CAGGAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0000672
Genomic location  G-integra Help Chromosome 1
Location 1p31.3
Position 65730437- 65881552
Strand +
Possible duplicated location(s) NA
Gene structure 19 exon(s)
Database links RefSeq NM_014787
Ensembl ENST00000263441ENST00000371069ENST00000395325ENST00000463018ENST00000472787ENST00000483402ENST00000494710ENST00000498720
Entrez Gene Entrez Gene ID:9829
KEGG GENES KEGG GENES(9829)
GeneCard GeneCardDNAJC6*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000066517
Predicted CDS 158..2899;  913[aa];  Orientation:+2; 
Codon Adaptation Index (CAI). 0.743
Database links RefSeq NP_055602
UniProt O75061
CCDS CCDS30739

Motif information
ORF

length(913),orf(158:2899)
MKDSENKGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSS
RVIQSVTSYTKGDLDFTYVTSRIIVMSFPLDNVDIGFRNQVDDIRSFLDS
RHLDHYTVYNLSPKSYRTAKFHSRVSECSWPIRQAPSLHNLFAVCRNMYN
WLLQNPKNVCVVHCLDGRAASSILVGAMFIFCNLYSTPGPAIRLLYAKRP
GIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPIPFFNKQRNG
CRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITVQGDVVVSM
YHLRSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVP
EKYPQLFQVTLDVELQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQD
TLALGGQAPIDIPPDNPRHYGQSGFFASLCWQDQKSEKSFCEEDHAALVN
QESEQSDDELLTLSSPHGNANGDKPHGVKKPSKKQQEPAAPPPPEDVDLL
GLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHP
SGPASTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFL
NTSSASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGGWDWHAKPGGFGM
GSKSAATSPTGSSHGTPTHQSKPQTLDPFADLGTLGSSSFASKPTTPTGL
GGGFPPLSSPQKASPQPMGGGWQQGGAYNWQQPQPKPQPSMPHSSPQNRP
NYNVSFSAMPGGQNERGKGSSNLEGKQKAADFEDLLSGQGFNAHKDKKGP
RTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETK
WKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDA
WSEFENQGQKPLY*
a.a.
length
InterPro Name
length(168), motif(55:222) 168 IPR014019 Phosphatase tensin type [Domain]
length(142), motif(226:367) 142 IPR008973 C2 calcium/lipid-binding domain, CaLB [Domain]
length(137), motif(227:363) 137 IPR014020 Tensin phosphatase, C2 domain [Domain]
length(139), motif(228:366) 139 IPR014020 Tensin phosphatase, C2 domain [Domain]
length(182), motif(732:913) 182 IPR001623 Heat shock protein DnaJ, N-terminal [Domain]
length(127), motif(783:909) 127 IPR001623 Heat shock protein DnaJ, N-terminal [Domain]
length(62), motif(848:909) 62 IPR001623 Heat shock protein DnaJ, N-terminal [Domain]
length(65), motif(849:913) 65 IPR001623 Heat shock protein DnaJ, N-terminal [Domain]
length(49), motif(861:909) 49 IPR001623 Heat shock protein DnaJ, N-terminal [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000000190
H-Inv cluster ID Locus viewHIX0000672
Accession number AB007942.1
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO;  Splicing isoformSplicing isoform
Coding potential  Help Protein coding; 
Definition Similar to Uncharacterized protein; Fragment;
Similarity category  Help Category: Similar to known protein(Category II).
Similar to known protein (F1N1H3)  [Identity/coverage = 95.675%/99.31%] to Bos taurus (Bovine). protein.
Experimental evidence Protein evidence
PubMed ID 19390049ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol DNAJC6
HGNC aliases NA
HGNC name DnaJ (Hsp40) homolog, subfamily C, member 6
DDBJ KIAA0473
UniProt DNAJC6
EC number EC 3.1.3.48protein-tyrosine-phosphatase; 
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway 04514 :Cell adhesion molecules (CAMs);  04520 :Adherens junction;  04630 :Jak-STAT signaling pathway;  04660 :T cell receptor signaling pathway;  04662 :B cell receptor signaling pathway;  04670 :Leukocyte transendothelial migration;  04910 :Insulin signaling pathway;  04920 :Adipocytokine signaling pathway;  04940 :Type I diabetes mellitus;  05120 :Epithelial cell signaling in Helicobacter pylori infection; 
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000066517
No. of interaction 2
Interaction partner(s) HIP000032098HIP000082853
BIND NA
DIP NA
MINT NA
HPRD 00350;  06256; 
IntAct NA
Database links RefSeq NM_014787
Ensembl ENST00000263441ENST00000371069ENST00000395325ENST00000463018ENST00000472787ENST00000483402ENST00000494710ENST00000498720
Entrez Gene Entrez Gene ID:9829
KEGG GENES KEGG GENES(9829)
GeneCard GeneCardDNAJC6*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA

Gene ontology information
Molecular function heat shock protein binding (GO:0031072); 

Subcellular localization information  Last modified:26-Mar-2013
WoLF PSORT nuclear;  cytosol;  golgi apparatus;  mitochondria; 
Target P Other
SOSUI membrane protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Protein structure information (GTOP) GTOP Last modified:26-Mar-2013
Start End PDB_ID E-value Identity Coverage SCOP_ID
77 212 1mkpA 2e-11 11.2 134/144 c.45.1.1
224 365 1d5rA1 5e-29 28.3 127/133 b.7.1.1
816 913 1nz6A 3e-22 95.9 98/98 a.2.3.1
Related H-InvDB links GTOP GTOP

Gene expression information  H-ANGEL DNAProbeLocator Last modified:26-Mar-2013
Tissue-specific expression  H-ANGEL neural; 
Probe
information DNAProbeLocator
AceGene AGhsA111620; 
Affymetrix
GeneChip
HG-Focus NA
HG-U133 204720_s_at;  204721_s_at; 
HG-U133A 204720_s_at;  204721_s_at; 
HG-U133A_2 204720_s_at;  204721_s_at; 
HG-U133B NA
HG-U133_Plus_2 204720_s_at;  204721_s_at; 
HG-U95 36022_at; 
HG-U95A 36022_at; 
HG-U95B NA
HG-U95C NA
HG-U95D NA
HG-U95E NA
HG-U95Av2 NA
HuEx-1_0 2340357;  2340377;  2340378;  2340379;  2340381;  2340384;  2340385;  2340386;  2340387;  2340388;  2340389;  2340390;  2340391;  2340392;  2340393;  2340394;  2340395;  2340396;  2340398;  2340399;  2340401;  2340402;  2340403;  2340404;  2340405;  2340406;  2416808; 
HuGeneFL NA
Agilent Human 1A Oligo Microarray:PGID215 A_23_P95359; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P147479;  A_23_P95359; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:26-Mar-2013
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  115665116600155600600975605225605606606788606852606928607317607671608543608553608995610320612367612596
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(9829)
Disease Entrez Gene ID:(9829)
Substance Entrez Gene ID:(9829)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
278 .. 278 T/C rs74486665 + CDS Synonymous[Leu41Leu]
383 .. 383 A/T rs61757223 + CDS Nonsynonymous[Met76Leu]
664 .. 664 G/A rs61753391 + CDS Synonymous[Ala169Ala]
1252 .. 1252 A/T rs61758427 + CDS Synonymous[Leu365Leu]
1442 .. 1442 C/T rs78141380 + CDS Nonsynonymous[Leu429Phe]
1486 .. 1486 A/G rs4325172 + CDS Synonymous[Glu443Glu]
1492 .. 1492 C/T rs11208644 + CDS Synonymous[His445His]
1676 ^ 1677 -/A rs35203656 + CDS
1696 .. 1696 G/A rs7551930 + CDS Synonymous[Pro513Pro]
1969 .. 1969 T/C rs12077111 + CDS Synonymous[Ser604Ser]
1996 .. 1996 C/A rs4582839 + CDS Synonymous[Pro613Pro]
2015 .. 2015 A/G rs77046530 + CDS Nonsynonymous[Thr620Ala]
2063 .. 2063 T/G rs76373786 + CDS Nonsynonymous[Ser636Ala]
2169 .. 2169 G/A rs4915691 + CDS Nonsynonymous[Ser671Asn]
2240 .. 2240 A/T rs113143702 + CDS Nonsynonymous[Thr695Ser]
2268 .. 2268 T/C rs77014468 + CDS Nonsynonymous[Phe704Ser]
2296 .. 2296 G/A rs113490907 + CDS Synonymous[Ala713Ala]
2437 .. 2437 T/G rs61733018 + CDS Synonymous[Pro760Pro]
3073 .. 3073 C/T rs9436293 + 3'UTR
3289 .. 3289 G/C rs112072071 + 3'UTR
3443 .. 3443 G/A rs10493377 + 3'UTR
3453 .. 3453 T/C rs75507639 + 3'UTR
3504 .. 3504 C/T rs9436732 + 3'UTR
3522 .. 3522 C/A rs11543262 + 3'UTR
3628 .. 3628 C/T rs114307796 + 3'UTR
3679 .. 3679 A/C rs12093960 + 3'UTR
3763 .. 3763 T/C rs77682017 + 3'UTR
3868 .. 3868 T/A rs9436733 + 3'UTR
3977 .. 3977 T/G rs41296144 + 3'UTR
4045 .. 4045 T/G rs41311152 + 3'UTR
4129 .. 4129 G/A rs114538485 + 3'UTR
4439 .. 4439 G/A rs41301082 + 3'UTR
4658 .. 4658 T/C rs112287683 + 3'UTR
5030 .. 5030 G/A rs1801792 + 3'UTR
5328 ^ 5329 -/AC rs68183979 + 3'UTR
5328 .. 5337 ACACACACAC/- rs111417975 + 3'UTR
5336 ^ 5337 -/AC rs71798235 + 3'UTR
5354 ^ 5355 -/AC rs72256996 + 3'UTR
5356 ^ 5357 -/AC/ACAC rs68089849 + 3'UTR
5364 ^ 5365 -/CA rs56339051 + 3'UTR
5365 ^ 5366 -/CA rs72296234 + 3'UTR
5369 .. 5369 C/T rs115102780 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
Location Variation Strand
5324..5363 (ac)20 +
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
U2 5694 5747 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene Repeat mask viewerRepeat Mask Viewer