H-InvDB x AHG DB
Transcript view
H-InvDB_8.3 released on March 26, 2013.
Search by for Advanced Search
Home Quick guide Navi BLAST Site map Download Contact us Help
Locus viewLocus view Protein view Protein view G-integraG-integra DiseaseInfo ViewerDiseaseInfo Viewer H-ANGELH-ANGEL EvolaEvola PPI viewerPPI view Gene Family/GroupGene Family/Group Hyperlink managemnet system (All databases)Hyperlink MS
H-Invitational ID: HIT000000030 Accession number: AB002322 Created date: 26-Mar-2013 Last modified: 20-Apr-2012
Definition: Serine/arginine repetitive matrix protein 2; 300 kDa nuclear matrix antigen; Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa; SR-related nuclear matrix protein of 300 kDa; Ser/Arg-related nuclear matrix protein of 300 kDa; Splicing coactivator subunit SRm300; Tax-responsive enhancer element-binding protein 803; TaxREB803;
 
 

Transcript original information
Accession number AB002322.3
CAGE tag ID NA
EST ID NA
Clone Number ee08846s1
Experimental resources NBRC: NITE Biological Resource Center  NBRC ; HGPD: Human Gene and Protein Database HGPD ; Antibody: searching human antibodies at "BIO-kaimono.com" Antibody (SRRM2) ; Catalog: searching experimental product catalogs at "BIO-kaimono.com" Catalog (SRRM2);
Sequence data provider Provider:KDRI
Annotation project H-Invitational FLcDNA
Length of cDNA 9003[bp] (No. of exon:15)[A:2205 T:1766 G:2209 C:2823]
Devision HUM
Molecular type mRNA
Library origin Cell type normal human aortic endothelial cells
Tissue type NA
Develpmental stage NA
Mini-G
Sequence quality information
CDS feature Complete CDS
Kozak sequence NA
PolyA NA
Vector/adapter sequence NA
Frame shift NA
Remaining intron NA
Splice site acceptor (NAGNAG) CAGCAG;  CAGGAG;  TAGCAG; 
Transcript quality feature NA
Notes NA

Gene structure information  G-integra H-DBAS cDNA-genome alignment
H-Inv cluster ID HIX0012738
Genomic location  G-integra Help Chromosome 16
Location 16p13.3
Position 2802678- 2821411
Strand +
Possible duplicated location(s) NA
Gene structure 15 exon(s)
Database links RefSeq NM_016333
Ensembl ENST00000301740ENST00000382300ENST00000382301ENST00000396975ENST00000544933
Entrez Gene Entrez Gene ID:23524
KEGG GENES KEGG GENES(23524)
GeneCard GeneCardSRRM2*GeneCards is provided free to academic non-profit institutions.
Related H-InvDB links H-DBASH-DBAS G-integraG-integra cDNA-genome alignmentcDNA-genome alignment

Predicted CDS information
HIP ID HIP000134552
Predicted CDS 202..8460;  2752[aa];  Orientation:+1; 
Codon Adaptation Index (CAI). 0.76

Motif information
ORF

length(2752),orf(202:8460)
MYNGIGLPTPRGSGTNGYVQRNLSLVRGRRGERPDYKGEEELRRLEAALV
KRPNPDILDHERKRRVELRCLELEEMMEEQGYEEQQIQEKVATFRLMLLE
KDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSS
FDPQRRAREAKQPAPEPPKPYSLVRESSSSRSPTPKQKKKKKKKDRGRRS
ESSSPRRERKKSSKKKKHRSESESKKRKHRSPTPKSKRKSKDKKRKRSRS
TTPAPKSRRAHRSTSADSASSSDTSRSRSRSAAAKTHTTALAGRSPSPAS
GRRGEGDAPFSEPGTTSTQRPSSPETATKQPSSPYEDKDKDKKEKSATRP
SPSPERSSTGPEPPAPTPLLAERHGGSPQPLATTPLSQEPVNPPSEASPT
RDRSPPKSPEKLPQSSSSESSPPSPQPTKVSRHASSSPESPKPAPAPGSH
REISSSPTSKNRSHGRAKRDKSHSHTPSRRMGRSRSPATAKRGRSRSRTP
TKRGHSRSRSPQWRRSRSAQRWGRSRSPQRRGRSRSPQRPGWSRSRNTQR
RGRSRSARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPT
RRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRSPARRSGRSRSR
TPARRGRSRSRTPARRGRSRSRTPARRSGRSRSRTPARRGRSRSRTPRRG
RSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSRSNSSPEMK
KSRISSRRSRSLSSPRSKAKSRLSLRRSLSGSSPCPKQKSQTPPRRSRSG
SSQTKAKSRTPPRRSRSSSSPPPKQKSKTPSRQSHSSSSPHPKVKSGTPP
RQGSITSPQANEQSVTPQRRSCFESSPDPELKSRTPSRHSCSGSSPPRVK
SSTPPRQSPSRSSSPQPKVKAIISPRQRSHSGSSSPSPSRVTSRTTPRRS
RSVSPCSNVESRLLPRYSHSGSSSPDTKVKPETPPRQSHSGSISPYPKVK
...
a.a.
length
InterPro Name
length(45), motif(51:95) 45 IPR013170 mRNA splicing factor, Cwf21 [Domain]

Gene function information  Gene family PPI viewer Similarity Search Tool TACT
H-Inv ID HIT000000030
H-Inv cluster ID Locus viewHIX0012738
Accession number AB002322.3
CAGE tag ID NA
EST ID NA
Transcript feature  Help NO; 
Coding potential  Help Protein coding; 
Definition Serine/arginine repetitive matrix protein 2; 300 kDa nuclear matrix antigen; Serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa; SR-related nuclear matrix protein of 300 kDa; Ser/Arg-related nuclear matrix protein of 300 kDa; Splicing coactivator subunit SRm300; Tax-responsive enhancer element-binding protein 803; TaxREB803;
Similarity category  Help Category: Identical to known human protein(Category I).
Identical to known human protein (Q9UQ35)  [Identity/coverage = 98.874%/100.0%] to Homo sapiens (Human). protein.
Experimental evidence Protein evidence
PubMed ID 920584195315371066880411004489119916381530293515489334156165531608328516565220169642431708198317287340175253321792467918187866182203361866964819007248193691951941333019608861196903321985487121269460ALL
Gene family/group Gene family H-Inv gene family/group ID NA
Gene family/group name NA
Evidence motif (InterPro) ID NA
Gene symbol/name HGNC symbol SRRM2
HGNC aliases NA
HGNC name serine/arginine repetitive matrix 2
DDBJ KIAA0324
UniProt SRRM2
EC number NA
GGDB
(GlycoGene Database)
Gene symbol NA
Familly NA
Designation NA
Expression NA
KEGG metabolic pathway NA
Protein-protein interaction (PPI) PPI viewer H-Inv protein ID HIP000134552
No. of interaction 16
Interaction partner(s) HIP000006280HIP000017241HIP000028618HIP000033272HIP000034631HIP000037399HIP000050194HIP000071164HIP000089031HIP000097016HIP000101685HIP000113997HIP000206539HIP000251926HIP000258529HIP000287963
BIND 182619;  24516; 
DIP 111843E; 
MINT MINT-2860098;  MINT-51381;  MINT-7234186;  MINT-7234199;  MINT-7234217;  MINT-7234231;  MINT-7234245;  MINT-7234259;  MINT-7234276;  MINT-7234292;  MINT-7234308;  MINT-7234326;  MINT-7234341; 
HPRD 00253;  00449;  00574;  00774;  02900;  03714;  04482;  06784; 
IntAct EBI-3451383;  EBI-2927718;  EBI-2927710;  EBI-3504327;  EBI-951898;  EBI-2927702;  EBI-2847091;  EBI-2866476;  EBI-2831397;  EBI-2695978;  EBI-2805759;  EBI-2696171;  EBI-1633268;  EBI-1633249;  EBI-2805752;  EBI-2797353; 
Database links RefSeq NM_016333
Ensembl ENST00000301740ENST00000382300ENST00000382301ENST00000396975ENST00000544933
Entrez Gene Entrez Gene ID:23524
KEGG GENES KEGG GENES(23524)
GeneCard GeneCardSRRM2*GeneCards is provided free to academic non-profit institutions.
etc H-GOLDHuman-Gene diversity Of Life-style related Diseases
Curation status Auto-annotated
Notes NA
Related H-InvDB links Gene familyGene family;  Similarity Search ToolSimilarity Search Tool;  TACTTACT
fRNAdb (The functional RNA database) : overlapping fRNAdb entries with H-InvDB transcripts based on the location of the genome. 
NA


Subcellular localization information  Last modified:20-Apr-2012
WoLF PSORT nuclear; 
Target P Other
SOSUI soluble protein
TMHMM soluble protein
PTS1 Not targeted
Related H-InvDB links LIFEdb LIFEdb; 
JRE-1.4.0 or later is required. Download JRE at Sun's web site.

Gene expression information  H-ANGEL DNAProbeLocator Last modified:20-Apr-2012
Tissue-specific expression  H-ANGEL NA
Probe
information DNAProbeLocator
AceGene AGhsA151502; 
Affymetrix
GeneChip
HG-Focus 208610_s_at; 
HG-U133 207435_s_at;  208610_s_at; 
HG-U133A 207435_s_at;  208610_s_at; 
HG-U133A_2 207435_s_at;  208610_s_at; 
HG-U133B NA
HG-U133_Plus_2 1554671_a_at;  207435_s_at;  208610_s_at; 
HG-U95 32761_at;  65441_at;  78525_at;  78527_g_at; 
HG-U95A 32761_at; 
HG-U95B NA
HG-U95C 65441_at; 
HG-U95D NA
HG-U95E 78525_at;  78527_g_at; 
HG-U95Av2 NA
HuEx-1_0 3645254;  3645256;  3645257;  3645258;  3645260;  3645262;  3645265;  3645267;  3645269;  3645271;  3645275;  3645278;  3645279;  3645280;  3645281;  3645282;  3645283;  3645284;  3645285;  3645286;  3645287;  3645288;  3645289;  3645290;  3645291;  3645292;  3645293;  3645294;  3645295;  3645296;  3645297;  3645298;  3645302;  3645303;  3645304;  3645309;  3645310;  3645311;  3645312;  3645313;  3645314;  3677140;  3677142;  3677143;  3677144;  3677145;  3677146;  3677147;  3677148;  3677149;  3677151;  3677153;  3677155;  3677157;  3677159;  3677161;  3677165; 
HuGeneFL X97301_at; 
Agilent Human 1A Oligo Microarray:PGID215 A_23_P152381;  A_23_P323166; 
Whole Human Genome Oligo Microarray:PGID247 A_23_P323166;  A_24_P50988; 
Related H-InvDB links H-ANGELH-ANGEL DNAProbeLocatorDNAProbeLocator

Disease/pathology information  DiseaseInfo Viewer LEGENDA Last modified:20-Apr-2012
Disease relation Disease name:NA
Related information in OMIM OMIM ID:NA Title:NA
Co-localized orphan diseases OMIM ID:  156850605013605021606668607339608558608903610260
Disease related mutation NA
Literature-Extracted GENe-Disease Associations (LEGENDA) LEGENDA Gene name Entrez Gene ID:(23524)
Disease Entrez Gene ID:(23524)
Substance Entrez Gene ID:(23524)
Related H-InvDB links DiseaseInfo ViewerDiseaseInfo ViewerLEGENDALEGENDA

Polymorphism (SNP, indel), microsatellite (Short Tandem Repeat, STR) and repeat information  VaryGene Repeat mask viewer
 Single Nucleotide Polymorphism (SNP) and indel  VaryGene
Location Variation dbSNP ID Strand CDS/UTR Translation
7 .. 7 T/C rs2240146 - 5'UTR
234 .. 234 G/T rs111402916 + CDS Synonymous[Arg11Arg]
286 .. 286 C/T rs11551732 + CDS Nonsynonymous[Arg29Cys]
615 .. 615 C/G rs74706545 + CDS Synonymous[Ala138Ala]
997 .. 997 G/T rs112146559 + CDS Nonsynonymous[Ala266Ser]
1038 .. 1038 T/C rs113566023 + CDS Synonymous[Ser279Ser]
1132 .. 1132 A/G rs79975303 + CDS Nonsynonymous[Ser311Gly]
1192 .. 1192 C/T rs79168841 + CDS Nonsynonymous[Pro331Ser]
1335 .. 1335 A/C rs117890014 + CDS Synonymous[Pro378Pro]
1505 .. 1505 G/C rs114899013 + CDS Nonsynonymous[Ser435Thr]
1736 .. 1736 A/C rs75813313 + CDS Nonsynonymous[Gln512Pro]
2014 .. 2014 C/T rs115253860 + CDS Nonsynonymous[Arg605Trp]
2154 .. 2154 C/T rs79910471 + CDS Synonymous[Thr651Thr]
2246 .. 2246 G/A rs116990973 + CDS Nonsynonymous[Arg682His]
2289 .. 2289 A/G rs75499358 + CDS Synonymous[Thr696Thr]
2319 .. 2319 C/T rs2240142 - CDS Synonymous[Ser706Ser]
2351 .. 2351 C/A rs116499978 + CDS Nonsynonymous[Thr717Lys]
2497 .. 2497 C/T rs113244516 + CDS Nonsynonymous[Arg766Trp]
2562 .. 2562 G/A rs2240141 - CDS Synonymous[Lys787Lys]
2593 .. 2593 C/T rs111652485 + CDS Nonsynonymous[Arg798Cys]
2611 .. 2611 A/C rs2240140 - CDS Nonsynonymous[Thr804Pro]
2768 .. 2768 C/G rs12185191 + CDS Nonsynonymous[Thr856Arg]
2797 .. 2797 A/G rs113836515 + CDS Nonsynonymous[Thr866Ala]
2849 .. 2849 C/G rs17136053 + CDS Nonsynonymous[Ser883Cys]
2963 .. 2963 C/A rs77172395 + CDS Nonsynonymous[Ala921Glu]
3040 .. 3040 C/T rs34275340 - CDS Nonsynonymous[Pro947Ser]
3127 ^ 3128 -/G rs34156460 + CDS
3145 .. 3145 G/A rs77942674 + CDS Nonsynonymous[Glu982Lys]
3150 .. 3150 A/C rs77210367 + CDS Synonymous[Thr983Thr]
3308 .. 3308 G/C rs72768765 + CDS Nonsynonymous[Cys1036Ser]
3624 .. 3624 C/G rs72768766 + CDS Nonsynonymous[Asp1141Glu]
3649 .. 3649 T/C rs35402245 - CDS Nonsynonymous[Ser1150Pro]
3746 .. 3746 G/T rs117384853 + CDS Nonsynonymous[Arg1182Ile]
3809 .. 3809 A/T rs9921332 + CDS Nonsynonymous[Lys1203Ile]
3834 .. 3834 A/G rs3094775 - CDS Synonymous[Arg1211Arg]
4133 .. 4133 C/T rs75894599 + CDS Nonsynonymous[Ser1311Phe]
4345 .. 4345 A/G rs112339953 + CDS Nonsynonymous[Ser1382Gly]
4362 .. 4362 C/T rs78949014 + CDS Synonymous[Ser1387Ser]
4699 .. 4699 C/G rs113263000 + CDS Nonsynonymous[Pro1500Ala]
4883 .. 4883 C/T rs28591365 + CDS Nonsynonymous[Ser1561Phe]
4909 .. 4909 C/A rs3094773 - CDS Synonymous[Arg1570Arg]
5318 .. 5318 G/A rs79121344 + CDS Nonsynonymous[Arg1706Lys]
5456 .. 5456 G/C rs114848780 + CDS Nonsynonymous[Arg1752Pro]
5857 .. 5857 C/T rs77226128 + CDS Nonsynonymous[Arg1886Cys]
6185 .. 6185 G/A rs111312335 + CDS Nonsynonymous[Arg1995Gln]
6299 .. 6299 G/C rs117133016 + CDS Nonsynonymous[Arg2033Pro]
6415 .. 6415 C/T rs34563620 - CDS Nonsynonymous[Pro2072Ser]
6557 .. 6557 G/A rs115704251 + CDS Nonsynonymous[Arg2119His]
6792 .. 6792 G/A rs118057303 + CDS Synonymous[Pro2197Pro]
6810 .. 6810 C/T rs61747729 + CDS Synonymous[Gly2203Gly]
6954 .. 6954 A/G rs111703345 + CDS Synonymous[Pro2251Pro]
7171 .. 7171 C/T rs61747731 + CDS Nonsynonymous[Pro2324Ser]
7522 .. 7522 C/T rs61747730 + CDS Nonsynonymous[Pro2441Ser]
7759 .. 7759 G/A rs112321557 + CDS Nonsynonymous[Ala2520Thr]
7769 .. 7769 C/G rs117824484 + CDS Nonsynonymous[Ala2523Gly]
7833 .. 7833 T/C rs2301802 - CDS Synonymous[Ser2544Ser]
7842 .. 7842 A/G rs114814069 + CDS Synonymous[Ser2547Ser]
7848 .. 7848 G/A rs117364218 + CDS Synonymous[Ser2549Ser]
7857 .. 7857 C/G rs59593256 + CDS Synonymous[Ser2552Ser]
7988 .. 7988 C/T rs111694508 + CDS Nonsynonymous[Pro2596Leu]
8115 .. 8115 C/T rs79439891 + CDS Synonymous[Ser2638Ser]
8299 .. 8299 C/T rs116681042 + CDS Nonsynonymous[Arg2700Cys]
8316 .. 8316 C/G rs35899615 + CDS Synonymous[Pro2705Pro]
8474 .. 8474 G/T rs1050134 + 3'UTR
8615 .. 8615 T/C rs78617860 + 3'UTR
8616 .. 8616 C/T rs11551731 - 3'UTR
8692 .. 8692 A/G rs111748580 + 3'UTR
8707 .. 8707 G/T rs75586278 + 3'UTR
8745 .. 8745 G/C rs112074102 + 3'UTR
8843 .. 8843 G/A rs8843 + 3'UTR
8927 .. 8927 C/T rs1050195 + 3'UTR
8974 .. 8974 T/C rs116928678 + 3'UTR
 Microsatellite (Short Tandem Repeat, STR)
Location Variation Strand
8056..8076 (tcc)7 +
 Microsatellite: Human-Gene diversity Of Life-style related Diseases (H-GOLD)
No data available
 Repeat  Repeat mask viewer
Type Start End Strand
MIRb 570 654 +
Database links H-GOLDHuman-Gene diversity Of Life-style related Diseases(H-GOLD)
Related H-InvDB links VaryGeneVaryGene;  Repeat mask viewerRepeat Mask Viewer